LOCUS       Exported                9259 bp ds-DNA     circular SYN 13-MAY-2021
DEFINITION  Contains ctrE, crtB, crtI, crtY, and idi genes of Erwinia herbicola 
            (Pantoea agglomerans) Eho10 and thereby produces beta-carotene in 
            Escherichia coli.
ACCESSION   .
VERSION     .
KEYWORDS    pAC-BETAipi
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9259)
  AUTHORS   Cunningham FX Jr, Gantt E
  TITLE     A study in scarlet: enzymes of ketocarotenoid biosynthesis in the 
            flowers of Adonis aestivalis.
  JOURNAL   Plant J. 2005 Feb;41(3):478-92.
  PUBMED    15659105
REFERENCE   2  (bases 1 to 9259)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plant J."; 
            date: "2005-02"; volume: "41(3)"; pages: "478-92"
FEATURES             Location/Qualifiers
     source          1..9259
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     primer_bind     134..153
                     /label=CAT-R
                     /note="Chloramphenicol resistance gene, reverse primer"
     promoter        complement(220..322)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding 
                     chloramphenicol acetyltransferase"
     primer_bind     complement(714..731)
                     /label=L4440
                     /note="L4440 vector, forward primer"
     rep_origin      complement(848..1393)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A 
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin.
                     "
     primer_bind     complement(928..947)
                     /label=pBR322ori-F
                     /note="pBR322 origin, forward primer"
     promoter        1505..1533
                     /label=tet promoter
                     /note="E. coli promoter for tetracycline efflux protein 
                     gene"
     primer_bind     complement(8592..8611)
                     /label=pBRrevBam
                     /note="pBR322 vectors, tet region, downstream of BamHI, 
                     reverse primer"
     CDS             complement(join(8819..9259,1..219))
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /label=CmR
                     /note="confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"