LOCUS       Exported                3451 bp ds-DNA     circular SYN 12-JUN-2021
DEFINITION  Expresses the S. pyogenes sgRNA from the H1 promoter .
ACCESSION   .
VERSION     .
KEYWORDS    phH1-gRNA
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3451)
  AUTHORS   Kabadi AM, Ousterout DG, Hilton IB, Gersbach CA
  TITLE     Multiplex CRISPR/Cas9-based genome engineering from a single 
            lentiviral vector.
  JOURNAL   Nucleic Acids Res. 2014 Aug 13. pii: gku749.
  PUBMED    25122746
REFERENCE   2  (bases 1 to 3451)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic 
            Acids Res. 2014 Aug 13. pii: gku749."
FEATURES             Location/Qualifiers
     source          1..3451
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     promoter        1..215
                     /label=H1 promoter
                     /note="human H1 RNA promoter"
     primer_bind     136..155
                     /label=H1
                     /note="Human H1 promoter, forward primer"
     misc_RNA        242..317
                     /label=gRNA scaffold
                     /note="guide RNA scaffold for the Streptococcus pyogenes 
                     CRISPR/Cas9 system"
     primer_bind     complement(362..382)
                     /label=T3
                     /note="T3 promoter, forward primer"
     promoter        complement(362..380)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(401..417)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     primer_bind     complement(401..417)
                     /label=M13 Reverse
                     /note="In lacZ gene. Also called M13-rev"
     primer_bind     complement(414..436)
                     /label=M13/pUC Reverse
                     /note="In lacZ gene"
     protein_bind    425..441
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(449..479)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    494..515
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     primer_bind     complement(632..649)
                     /label=L4440
                     /note="L4440 vector, forward primer"
     rep_origin      complement(803..1391)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     primer_bind     complement(883..902)
                     /label=pBR322ori-F
                     /note="pBR322 origin, forward primer"
     CDS             complement(1468..2262)
                     /codon_start=1
                     /gene="aph(3)-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /label=NeoR/KanR
                     /note="confers resistance to neomycin, kanamycin, and G418 
                     (Geneticin(R))"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     primer_bind     complement(1579..1598)
                     /label=Neo-F
                     /note="Neomycin resistance gene, forward primer"
     primer_bind     2189..2208
                     /label=Neo-R
                     /note="Neomycin resistance gene, reverse primer"
     promoter        complement(2297..2654)
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     rep_origin      2311..2446
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     primer_bind     complement(2365..2384)
                     /label=SV40pro-F
                     /note="SV40 promoter/origin, forward primer"
     primer_bind     2611..2631
                     /label=pBABE 3
                     /note="SV40 enhancer, reverse primer for pBABE vectors"
     promoter        complement(2656..2760)
                     /gene="bla"
                     /label=AmpR promoter
     rep_origin      complement(2786..3241)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     primer_bind     complement(2923..2944)
                     /label=F1ori-F
                     /note="F1 origin, forward primer"
     primer_bind     3135..3154
                     /label=F1ori-R
                     /note="F1 origin, reverse primer"
     primer_bind     3368..3390
                     /label=M13/pUC Forward
                     /note="In lacZ gene"
     primer_bind     3382..3399
                     /label=M13 Forward
                     /note="In lacZ gene. Also called M13-F20 or M13 (-21) 
                     Forward"
     primer_bind     3383..3399
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     primer_bind     3409..3428
                     /label=T7
                     /note="T7 promoter, forward primer"
     promoter        3409..3427
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"