LOCUS       Exported                3529 bp ds-DNA     circular SYN 10-SEP-2021
DEFINITION  In vivo homologous recombination substrate composed of two 
            differentially mutated GFP genes oriented as direct repeats and 
            separated by a drug selection marker .
ACCESSION   .
VERSION     .
KEYWORDS    pDRGFP
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3529)
  AUTHORS   Pierce AJ, Johnson RD, Thompson LH, Jasin M
  TITLE     XRCC3 promotes homology-directed repair of DNA damage in mammalian 
            cells.
  JOURNAL   Genes Dev. 1999 Oct 15. 13(20):2633-8.
  PUBMED    10541549
REFERENCE   2  (bases 1 to 3529)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Genes Dev. 
            1999 Oct 15. 13(20):2633-8."
FEATURES             Location/Qualifiers
     source          1..3529
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     primer_bind     30..51
                     /label=EGFP-N
                     /note="EGFP, reverse primer"
     regulatory      93..102
                     /regulatory_class="other"
                     /label=Kozak sequence
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     CDS             complement(316..336)
                     /codon_start=1
                     /product="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
                     /label=SV40 NLS
                     /translation="PKKKRKV"
     CDS             complement(358..378)
                     /codon_start=1
                     /product="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
                     /label=SV40 NLS
                     /translation="PKKKRKV"
     primer_bind     724..743
                     /label=rbglobpA-R
                     /note="Rabbit beta-globin polyA, reverse primer. Also 
                     called rb-glob-pA-term-R"
     polyA_signal    742..797
                     /label=beta-globin poly(A) signal
                     /note="rabbit beta-globin polyadenylation signal (Gil and 
                     Proudfoot, 1987)"
     primer_bind     843..862
                     /label=Bglob-pA-R
                     /note="Rabbit beta-globin polyA region, reverse primer"
     promoter        950..1447
                     /label=PGK promoter
                     /note="mouse phosphoglycerate kinase 1 promoter"
     primer_bind     complement(985..1008)
                     /label=MSCV-rev
                     /note="Murine stem cell virus, reverse primer"
     primer_bind     1380..1399
                     /label=mPGK-F
                     /note="Mouse PGK promoter, forward primer"
     CDS             1466..2065
                     /codon_start=1
                     /gene="pac from Streptomyces alboniger"
                     /product="puromycin N-acetyltransferase"
                     /label=PuroR
                     /note="confers resistance to puromycin"
                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER
                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA
                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS
                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"
     primer_bind     complement(1466..1485)
                     /label=Puro-R
                     /note="Puromycin resistance gene, reverse primer. Also 
                     called puro-variant-R"
     primer_bind     1962..1982
                     /label=Puro-F
                     /note="Puromycin resistance gene, forward primer"
     polyA_signal    2726..2847
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(2737..2756)
                     /label=EBV-rev
                     /note="SV40 polyA terminator, reverse primer"
     primer_bind     2791..2810
                     /label=SV40pA-R
                     /note="SV40 polyA, reverse primer"
     primer_bind     complement(3015..3036)
                     /label=EGFP-C
                     /note="EGFP, forward primer"
     primer_bind     3364..3383
                     /label=EXFP-R
                     /note="For distinguishing EGFP variants, reverse primer"