LOCUS       Exported                7375 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector pWB206, complete sequence.
ACCESSION   EF216325
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7375)
  AUTHORS   Bourn WR, Shephard E, Powels R, Stutz H, Douglas N, Jaffray A, 
            Williamson A-L.
  TITLE     The use of guided evolution to create a stable, immunogenic HIV-1 
            antigen expressing recombinant BCG
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7375)
  AUTHORS   Shephard E, Bourn WR, Stutz H, Johnston N, van Harmelen JH, 
            Williamson C, Douglass N, Bowers D, Galant S, Isaacs Z, Binder A, 
            Williamson A-L.
  TITLE     Priming with a rBCG or DNA vaccine expressing HIV-I subtype C Gag 
            elicits comparable CD8+ T cell responses when boosted by a rMVA 
            expressing GagC
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 7375)
  AUTHORS   Bourn WR.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JAN-2007) Medical Virology and Institute of Infectious
            Disease and Molecular Medicine, University of Cape Town, Anzio Road 
            Observatory, Cape Town 7925, South Africa
REFERENCE   4  (bases 1 to 7375)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..7375
                     /organism="Expression vector pWB206"
                     /mol_type="other DNA"
                     /db_xref="taxon:423234"
     CDS             120..935
                     /codon_start=1
                     /gene="aph"
                     /product="glycoside-3-phosphotransferase"
                     /label=aph
                     /note="kanamycin resistance"
                     /protein_id="ABN14098.1"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPHAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHNLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     gene            120..935
                     /gene="aph"
                     /label=aph
     rep_origin      1222..2009
                     /note="derived from Escherichia coli; OriE"
     rep_origin      1267..1855
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     rep_origin      2215..4799
                     /note="mycobacterial origin; OriM"
     primer_bind     4829..4845
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      4857..4943
                     /regulatory_class="promoter"
                     /note="BCG hsp60"
     regulatory      4967..4973
                     /regulatory_class="ribosome_binding_site"
                     /note="strong synthetic Shine Delgarno sequence; RBSA"
     gene            5010..5372
                     /gene="tat"
                     /label=tat
                     /note="shuffled BCG codon optimized tat gene from HIV-1 
                     subtype C isolate"
     gene            5382..5804
                     /gene="gag"
                     /label=gag
                     /note="truncated fragment of BCG codon optimized gag gene 
                     from HIV-1 subtype C isolate"
     regulatory      5689..5695
                     /regulatory_class="ribosome_binding_site"
                     /gene="gag"
                     /note="fortuitous RBSD"
     gene            5807..6460
                     /gene="gag"
                     /label=gag
                     /note="truncated fragment of BCG codon optimized gag gene 
                     from HIV-1 subtype C isolate"
     misc_feature    6518..6547
                     /label=Gag-GFP linker sequence
                     /note="Gag-GFP linker sequence"
     gene            6548..7261
                     /gene="gfp"
                     /label=gfp
                     /note="green fluorescent protein"
     terminator      7293..7339
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB 
                     gene"
     regulatory      7296..7339
                     /regulatory_class="terminator"
                     /note="rrnBT1"