LOCUS       Exported                3633 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pTn7xT, complete sequence.
ACCESSION   KF813060
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3633)
  AUTHORS   Bruckbauer ST, Kvitko BH, Karkhoff-Schweizer RR, Schweizer HP.
  TITLE     Tn5/7-lux: A versatile tool for the identification and capture of 
            promoters in Gram-negative bacteria
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3633)
  AUTHORS   Bruckbauer ST, Kvitko BH, Karkhoff-Schweizer RR, Schweizer HP.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-NOV-2013) Microbiology, Immunology and Pathology, 
            Colorado State University, 2025 Campus Delivery, Fort Collins, CO 
            80523, USA
REFERENCE   3  (bases 1 to 3633)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..3633
                     /organism="Cloning vector pTn7xT"
                     /lab_host="Escherichia coli"
                     /mol_type="other DNA"
                     /db_xref="taxon:1454557"
     misc_feature    58..105
                     /label=FRT site
                     /note="FRT site"
     protein_bind    complement(58..105)
                     /label=FRT
                     /bound_moiety="FLP recombinase from the Saccharomyces 
                     cerevisiae 2u plasmid"
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     promoter        157..185
                     /gene="intI1 (promoter lies within the coding sequence)"
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     CDS             512..748
                     /codon_start=1
                     /gene="dhfRII"
                     /product="trimethoprim resistant dihydrofolate reductase"
                     /label=dhfRII
                     /protein_id="AHH35070.1"
                     /translation="MGQSSDEANAPVAGQFALPLSATFGLGDRVRKKSGAAWQGQVVGW
                     YCTKLTPEGYAVESESHPGSVQIYPVAALERVA"
     gene            512..748
                     /gene="dhfRII"
                     /label=dhfRII
     misc_feature    810..857
                     /label=FRT site
                     /note="FRT site"
     protein_bind    complement(810..857)
                     /label=FRT
                     /bound_moiety="FLP recombinase from the Saccharomyces 
                     cerevisiae 2u plasmid"
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     regulatory      898..995
                     /regulatory_class="terminator"
                     /note="phage lambda"
     terminator      903..989
                     /gene="Escherichia coli rrnB"
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB 
                     gene"
     regulatory      1092..1186
                     /regulatory_class="terminator"
                     /note="Escherichia coli rrnB operon"
     terminator      1092..1186
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"
     primer_bind     complement(1214..1230)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     repeat_region   1235..1433
                     /note="Tn7R; Tn7 right end"
     oriT            2033..2294
     oriT            2179..2287
                     /note="incP origin of transfer"
     rep_origin      2318..2699
                     /label=R6K
                     /note="R6K"
     rep_origin      2338..2694
                     /label=R6K gamma ori
                     /note="gamma replication origin from E. coli plasmid R6K; 
                     requires the R6K initiator protein pi for replication"
     mobile_element  2910..3075
                     /mobile_element_type="transposon:Tn7"
                     /note="mini-Tn7 element (left end of the Tn7 transposon)"
     protein_bind    3106..3130
                     /gene="mutant version of attB"
                     /label=attB1
                     /bound_moiety="BP Clonase(TM)"
                     /note="recombination site for the Gateway(R) BP reaction"
     regulatory      3161..3626
                     /regulatory_class="promoter"
                     /note="Pseudomonas aeruginosa PA4974 gene"