LOCUS       Exported                5793 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cosmid vector pTL5, complete sequence.
ACCESSION   U07340
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5793)
  AUTHORS   Slightom JL, Siemieniak DR, Koop BF, Hood L.
  TITLE     The complete nucleotide sequence of cosmid vector pTL5: location and
            origin of its genetic components
  JOURNAL   Gene 147 (1), 77-79 (1994)
  PUBMED    8088551
REFERENCE   2  (bases 1 to 5793)
  AUTHORS   Sutcliffe JG.
  TITLE     Complete nucleotide sequence of the Escherichia coli plasmid pBR322
  JOURNAL   Cold Spring Harb. Symp. Quant. Biol. 43 (PT 1), 77-90 (1979)
  PUBMED    383387
REFERENCE   3  (bases 1 to 5793)
  AUTHORS   Daniels DL, Schroeder JL, Szybalski W, Sanger F, Blattner FR.
  TITLE     Appendix I: A Molecular Map of Coliphage Lambda
  JOURNAL   (in) Hendrix,R.W. (Ed.); LAMBDA II: 519-676; Cold Spring Harbor 
            Laboratory, Cold Spring Harbor, NY (1983)
REFERENCE   4  (bases 1 to 5793)
  AUTHORS   Lund T, Grosveld FG, Flavell RA.
  TITLE     Isolation of transforming DNA by cosmid rescue
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 79 (2), 520-524 (1982)
  PUBMED    6210908
REFERENCE   5  (bases 1 to 5793)
  AUTHORS   Slightom JL.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-MAR-1994) Jerry L. Slightom, Molecular Biology, The 
            Upjohn Company, 301 Henrietta Street, Kalamazoo, MI 49007, USA
REFERENCE   6  (bases 1 to 5793)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..5793
                     /organism="Cloning vector pTL5"
                     /lab_host="Escherichia coli"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:33781"
     promoter        10..38
                     /label=tet promoter
                     /note="E. coli promoter for tetracycline efflux protein 
                     gene"
     CDS             86..1276
                     /codon_start=1
                     /gene="tet"
                     /product="tetracycline efflux protein"
                     /label=TcR
                     /note="confers resistance to tetracycline"
                     /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY
                     GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI
                     VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF
                     LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM
                     QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII
                     AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL
                     AALTSLTSIIGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST"
     misc_feature    1461..2113
                     /note="DNA region from bacteriophage lambda, known as the 
                     lambda cro-cII region. Shares 100% identity with lambda 
                     sequence, GenBank Accession Number J02459"
     terminator      1537..1631
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"
     misc_feature    2114..3448
                     /note="Sequence region obtained from bacteriophage Charon 
                     4A, but originally from bacteriophage phi 80. phi 80 right 
                     arm region"
     misc_feature    3437..3448
                     /label=bacteriophage Charon 4A cohesive ends
                     /note="bacteriophage Charon 4A cohesive ends"
     misc_feature    3449..3854
                     /note="DNA region from Charon 4A, originally from 
                     bacteriophage lambda, left arm region"
     misc_feature    3573
                     /note="left arm of bacteriophage lambda (GenBank Accession 
                     Number J02459) differs after this position as it contains 
                     one additional G nucleotide not found in pTL5"
     rep_origin      3855..5793
                     /note="DNA region from pBR322, contains the ColE1 ori. 
                     Sequence shares 100% identity with GenBank Accession Number
                     J01749 (pBR322)"
     CDS             4102..4293
                     /codon_start=1
                     /gene="rop"
                     /product="Rop protein, which maintains plasmids at low copy
                     number"
                     /label=rop
                     /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
                     DELYRSCLARFGDDGENL"
     misc_feature    4395..4535
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(4721..5308)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"