LOCUS       Exported                8424 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Mammalian expression vector pSV55i2, complete sequence.
ACCESSION   LT727502
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8424)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman 
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 8424)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, 
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 8424)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..8424
                     /organism="Mammalian expression vector pSV55i2"
                     /mol_type="other DNA"
                     /note="BCCM/LMBP Plasmid collection (Ghent 
                     University,Belgium) accession number LMBP 2338."
                     /db_xref="taxon:1945119"
     regulatory      1..278
                     /regulatory_class="promoter"
                     /note="SV40 early promoter"
     promoter        6..335
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     rep_origin      186..321
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     rep_origin      235..310
                     /label=SV40 ori
                     /note="SV40 ori"
     misc_feature    349..877
                     /label=SV40 small t-antigen
                     /note="SV40 small t-antigen"
     misc_feature    349..594
                     /label=SV40 large T-antigen
                     /note="SV40 large T-antigen"
     misc_feature    595..944
                     /label=intron
                     /note="intron"
     intron          879..944
                     /label=small t intron
                     /note="SV40 (simian virus 40) small t antigen intron"
     misc_feature    945..2825
                     /label=SV40 large T-antigen
                     /note="SV40 large T-antigen"
     CDS             1074..1094
                     /codon_start=1
                     /product="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
                     /label=SV40 NLS
                     /translation="PKKKRKV"
     regulatory      complement(2826..2922)
                     /regulatory_class="terminator"
                     /note="polyA"
     regulatory      2826..2922
                     /regulatory_class="terminator"
                     /note="polyA"
     polyA_signal    2848..2982
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     misc_feature    complement(3019..3956)
                     /label=intron
                     /note="intron"
     misc_feature    complement(3957..4159)
                     /label=5UTR
                     /note="5UTR"
     regulatory      complement(4192..4459)
                     /regulatory_class="promoter"
                     /note="SV40 late promoter"
     promoter        4196..4553
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     regulatory      4215..4496
                     /regulatory_class="promoter"
                     /note="SV40 early promoter"
     rep_origin      4404..4539
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     rep_origin      4453..4528
                     /label=SV40 ori
                     /note="SV40 ori"
     CDS             4567..5091
                     /codon_start=1
                     /note="unnamed protein product; SV40 small t-antigen"
                     /protein_id="SJL88673.1"
                     /translation="MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDK
                     GGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEVFASSLNPGVDAMYCKQWPECA
                     KKMSANCICLLCLLRMKHENRKLYRKDPLVWVDCYCFDCFRMWFGLDLCEGTLLLWCDI
                     IGQTTYRDLKL"
     misc_feature    4567..4812
                     /label=SV40 large T-antigen
                     /note="SV40 large T-antigen"
     misc_feature    4813..5158
                     /label=intron
                     /note="intron"
     intron          4813..5158
                     /label=large T intron
                     /note="SV40 (simian virus 40) large T antigen intron"
     misc_feature    5159..6221
                     /label=part of SV40 large t-antigen
                     /note="part of SV40 large t-antigen"
     CDS             5288..5308
                     /codon_start=1
                     /product="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
                     /label=SV40 NLS
                     /translation="PKKKRKV"
     misc_feature    6363..6503
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(6505..6905)
                     /direction=LEFT
                     /label=pMB1 ori
                     /note="pMB1 ori"
     rep_origin      complement(6689..7277)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(7448..8308)
                     /codon_start=1
                     /note="unnamed protein product; ampicillin resistance"
                     /protein_id="SJL88674.1"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(8309..8413)
                     /gene="bla"
                     /label=AmpR promoter