LOCUS       Exported                8774 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Integration vector pSMB47 for Tn5251 and Tn916, complete sequence.
ACCESSION   U69267
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8774)
  AUTHORS   Brehm J, Salmond G, Minton N.
  TITLE     Sequence of the adenine methylase gene of the Streptococcus faecalis
            plasmid pAM beta 1
  JOURNAL   Nucleic Acids Res. 15 (7), 3177 (1987)
  PUBMED    3104884
REFERENCE   2  (bases 1 to 8774)
  AUTHORS   Rose RE.
  TITLE     The nucleotide sequence of pACYC184
  JOURNAL   Nucleic Acids Res. 16 (1), 355 (1988)
  PUBMED    3340533
REFERENCE   3  (bases 1 to 8774)
  AUTHORS   Kilic AO, Vijayakumar MN, al-Khaldi SF.
  TITLE     Identification and nucleotide sequence analysis of a 
            transfer-related region in the streptococcal conjugative transposon 
            Tn5252
  JOURNAL   J. Bacteriol. 176 (16), 5145-5150 (1994)
  PUBMED    8051031
REFERENCE   4  (bases 1 to 8774)
  AUTHORS   Provvedi R, Manganelli R, Pozzi G.
  TITLE     Characterization of conjugative transposon Tn5251 of Streptococcus 
            pneumoniae
  JOURNAL   FEMS Microbiol. Lett. 135 (2-3), 231-236 (1996)
  PUBMED    8595862
REFERENCE   5  (bases 1 to 8774)
  AUTHORS   Manganelli R, Provvedi R, Berneri C, Oggioni MR, Pozzi G.
  TITLE     Insertion vectors for in vivo construction of recombinant 
            conjugative transposons
  JOURNAL   Unpublished
REFERENCE   6  (bases 1 to 8774)
  AUTHORS   Manganelli R, Provvedi R, Berneri C, Oggioni MR, Pozzi G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-1996) Microbiology, University of Siena, Via 
            Laterina 8, Siena, Si 53100, Italy
REFERENCE   7  (bases 1 to 8774)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..8774
                     /organism="Integration vector pSMB47"
                     /mol_type="genomic DNA"
                     /note="The insertion plasmid contains sequences homologous 
                     to transposon Tn5251 which flank the erythromycin 
                     resistance marker ermB and the replication origin of 
                     pACYC184 and which permit integration into the transposons 
                     by double cross-over"
                     /db_xref="taxon:52270"
     misc_feature    1..1028
                     /note="similar to Enterococcus faecalis Tn916 of GenBank 
                     Accession Number U09422"
                     /citation="[4]"
     misc_feature    1025..1263
                     /note="similar to S. pneumoniae Tn5252 of GenBank Accession
                     Number L29324"
                     /citation="[3]"
     misc_feature    1258..2062
                     /note="similar to cloning vector pACYC184 of GenBank 
                     Accession Number X06403"
                     /citation="[2]"
     CDS             complement(1622..2281)
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /label=CmR
                     /note="confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     misc_feature    2063..3585
                     /note="similar to cloning vector pACYC184 of GenBank 
                     Accession Number X06403"
                     /citation="[2]"
     promoter        complement(2282..2384)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding 
                     chloramphenicol acetyltransferase"
     rep_origin      complement(2910..3455)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A 
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     misc_feature    3586..4712
                     /note="similar to S. Faecalis plasmid pAM-beta1 of GenBank 
                     Accession Number Y00116"
                     /citation="[1]"
     misc_feature    4459..5370
                     /note="similar to S. agalactiae pIP501 of GenBank Accession
                     Number U00453"
     misc_feature    5365..7290
                     /note="similar to cloning vector pACYC184 of GenBank 
                     Accession Number X06403"
                     /citation="[2]"
     CDS             5422..6612
                     /codon_start=1
                     /gene="tet"
                     /product="tetracycline efflux protein"
                     /label=TcR
                     /note="confers resistance to tetracycline"
                     /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY
                     GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI
                     VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF
                     LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM
                     QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII
                     AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL
                     AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST"
     misc_feature    7423..8773
                     /note="similar to S. pneumoniae tet(M) gene of GenBank 
                     Accession Number X90939"
                     /citation="[4]"