LOCUS       Exported                3905 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pSI-DSZ2cx-DI, complete sequence.
ACCESSION   KX001773
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3905)
  AUTHORS   Mansouri M, Bellon-Echeverria I, Rizk A, Ehsaei Z, Cianciolo 
            Cosentino C, Silva CS, Xie Y, Boyce FM, Davis MW, Neuhauss SC, 
            Taylor V, Ballmer-Hofer K, Berger I, Berger P.
  TITLE     Highly efficient baculovirus-mediated multigene delivery in primary 
            cells
  JOURNAL   Nat Commun 7, 11529 (2016)
  PUBMED    27143231
REFERENCE   2  (bases 1 to 3905)
  AUTHORS   Mansouri M, Berger I, Berger P.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAR-2016) Laboratory of Biomolecular Research, Paul 
            Scherrer Institute, OFLG-110, Villigen psi 5232, Switzerland
REFERENCE   3  (bases 1 to 3905)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Ape v. v. v2.0.49
            Sequencing Technology :: 454; Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3905
                     /organism="Cloning vector pSI-DSZ2cx-DI"
                     /mol_type="other DNA"
                     /db_xref="taxon:1842887"
     rep_origin      7..363
                     /label=R6K gamma ori
                     /note="gamma replication origin from E. coli plasmid R6K; 
                     requires the R6K initiator protein pi for replication"
     protein_bind    416..449
                     /label=loxP
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GCATACAT)."
     enhancer        525..827
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        828..1031
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     promoter        1213..1322
                     /label=p10 promoter
                     /note="baculovirus promoter for expression in insect cells"
     protein_bind    1459..1480
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     promoter        1495..1525
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    1533..1549
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     1557..1573
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        1591..1609
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"
     polyA_signal    1802..1849
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase 
                     polyadenylation signal (Cole and Stacy, 1985)"
     regulatory      1959..1968
                     /regulatory_class="other"
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     promoter        complement(1999..2017)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(2024..2040)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     polyA_signal    2329..2553
                     /label=bGH poly(A) signal
                     /note="bovine growth hormone polyadenylation signal"
     CDS             complement(2658..3449)
                     /codon_start=1
                     /gene="aadA"
                     /product="aminoglycoside adenylyltransferase (Murphy, 
                     1985)"
                     /label=SmR
                     /note="confers resistance to spectinomycin and 
                     streptomycin"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"