LOCUS       Exported                4148 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pSI-AGZ10, complete sequence.
ACCESSION   KX001771
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4148)
  AUTHORS   Mansouri M, Bellon-Echeverria I, Rizk A, Ehsaei Z, Cianciolo 
            Cosentino C, Silva CS, Xie Y, Boyce FM, Davis MW, Neuhauss SC, 
            Taylor V, Ballmer-Hofer K, Berger I, Berger P.
  TITLE     Highly efficient baculovirus-mediated multigene delivery in primary 
            cells
  JOURNAL   Nat Commun 7, 11529 (2016)
  PUBMED    27143231
REFERENCE   2  (bases 1 to 4148)
  AUTHORS   Mansouri M, Berger I, Berger P.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAR-2016) Laboratory of Biomolecular Research, Paul 
            Scherrer Institute, OFLG-110, Villigen psi 5232, Switzerland
REFERENCE   3  (bases 1 to 4148)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Ape v. v. v2.0.49
            Sequencing Technology :: 454; Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4148
                     /organism="Cloning vector pSI-AGZ10"
                     /mol_type="other DNA"
                     /db_xref="taxon:1842885"
     mobile_element  33..198
                     /mobile_element_type="transposon:Tn7"
                     /note="mini-Tn7 element (left end of the Tn7 transposon)"
     rep_origin      388..976
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     mobile_element  1111..1334
                     /mobile_element_type="transposon:Tn7"
                     /note="mini-Tn7 element (right end of the Tn7 transposon)"
     CDS             complement(1401..1934)
                     /codon_start=1
                     /gene="aacC1"
                     /product="gentamycin acetyltransferase"
                     /label=GmR
                     /note="confers resistance to gentamycin"
                     /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD
                     LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQPRS
                     EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR
                     EEVMHFDIDPSTAT"
     promoter        complement(2123..2151)
                     /gene="intI1 (promoter lies within the coding sequence)"
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     protein_bind    2222..2255
                     /label=loxP
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GCATACAT)."
     enhancer        2347..2650
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        2651..2854
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     promoter        2899..2917
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     protein_bind    3019..3040
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     promoter        3055..3085
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    3093..3109
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     3117..3133
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        3151..3169
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"
     polyA_signal    3362..3409
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase 
                     polyadenylation signal (Cole and Stacy, 1985)"
     regulatory      3519..3528
                     /regulatory_class="other"
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     promoter        complement(3559..3577)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(3584..3600)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     polyA_signal    3889..4113
                     /label=bGH poly(A) signal
                     /note="bovine growth hormone polyadenylation signal"