LOCUS       Exported                8092 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Shuttle vector pSC-R1LambdaR2, complete sequence.
ACCESSION   JN128952
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8092)
  AUTHORS   Choi EW, Seen DS, Song YB, Son HS, Jung NC, Huh WK, Hahn JS, Kim K, 
            Jeong JY, Lee TG.
  TITLE     AdHTS: a high-throughput system for generating recombinant 
            adenoviruses
  JOURNAL   J. Biotechnol. 162 (2-3), 246-252 (2012)
  PUBMED    23063969
REFERENCE   2  (bases 1 to 8092)
  AUTHORS   Choi E-W., Seen D-S., Son H-S., Song YB, Huh W-K., Hahn J-S., Kim K,
            Jeong J-Y., Lee TG.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JUN-2011) R&D Center, BRN Science Inc., 3F, Golden 
            Helix, Seoul National University, Seoul 151-742, Republic of Korea
REFERENCE   3  (bases 1 to 8092)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..8092
                     /organism="Shuttle vector pSC-R1LambdaR2"
                     /mol_type="other DNA"
                     /db_xref="taxon:1046567"
     misc_feature    4..345
                     /label=from human adenovirus 5
                     /note="from human adenovirus 5"
     repeat_region   4..106
                     /label=left inverted terminal repeat (LITR)
                     /note="left inverted terminal repeat (LITR)"
     misc_signal     194..344
                     /label=Ad5 Psi
                     /note="packaging signal for adenovirus serotype 5"
     regulatory      400..930
                     /regulatory_class="promoter"
                     /note="CMV promoter"
     enhancer        402..705
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        706..909
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     misc_feature    949..1073
                     /label=attR1
                     /note="attR1"
     protein_bind    949..1073
                     /gene="mutant version of attR"
                     /label=attR1
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     misc_feature    1464..1588
                     /label=attR2
                     /note="attR2"
     protein_bind    complement(1464..1588)
                     /gene="mutant version of attR"
                     /label=attR2
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     regulatory      1747..1868
                     /regulatory_class="polyA_signal_sequence"
                     /note="SV40 polyadenylation sequence"
     polyA_signal    1747..1868
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     misc_feature    1887..4133
                     /label=from human adenovirus 5
                     /note="from human adenovirus 5"
     misc_feature    4157..5157
                     /label=from human adenovirus 5
                     /note="from human adenovirus 5"
     repeat_region   5055..5157
                     /label=right inverted terminal repeat (RITR)
                     /note="right inverted terminal repeat (RITR)"
     rep_origin      complement(5417..6005)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     rep_origin      5417..5950
                     /label=pUC19 ori
                     /note="pUC19 ori"
     CDS             6837..7631
                     /codon_start=1
                     /product="kanamycin resistance protein"
                     /label=kanamycin resistance protein
                     /note="Kan"
                     /protein_id="AEJ89477.1"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     rep_origin      complement(7679..8058)
                     /direction=LEFT
                     /label=M13 ori
                     /note="M13 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"