LOCUS       Exported               12687 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  YFV replicon vector prME-def, complete sequence.
ACCESSION   DQ322635
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12687)
  AUTHORS   Shustov AV, Frolov IV.
  TITLE     Trans-packaging of Yellow Fever virus replicons: an approach for 
            flaviviral antigen production
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 12687)
  AUTHORS   Shustov AV, Frolov IV.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-DEC-2005) Department of Microbiology and Immunology, 
            University of Texas Medical Branch, 301 University Boulevard, 
            Galveston, TX 77550-1019, USA
REFERENCE   3  (bases 1 to 12687)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..12687
                     /organism="YFV replicon vector prME-def"
                     /focus
                     /lab_host="Escherichia coli"
                     /mol_type="other DNA"
                     /db_xref="taxon:364085"
     source          2..506
                     /organism="Yellow fever virus 17D"
                     /mol_type="other DNA"
                     /db_xref="taxon:11090"
     source          1215..9774
                     /organism="Yellow fever virus 17D"
                     /mol_type="other DNA"
                     /db_xref="taxon:11090"
     misc_feature    2..119
                     /label=5UTR of Yellow fever virus 17D
                     /note="5UTR of Yellow fever virus 17D"
     misc_feature    120..482
                     /label=Yellow fever virus 17D capsid protein
                     /note="Yellow fever virus 17D capsid protein"
     misc_feature    483..500
                     /label=first 6 aa from pr Yellow fever virus 17D
                     /note="first 6 aa from pr Yellow fever virus 17D"
     misc_feature    507..1214
                     /label=cherry fluorescent protein (CFP)
                     /note="cherry fluorescent protein (CFP)"
     CDS             507..1211
                     /codon_start=1
                     /product="monomeric derivative of DsRed fluorescent protein
                     (Shaner et al., 2004)"
                     /label=mCherry
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEG
                     TQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF
                     EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK
                     GEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERA
                     EGRHSTGGMDELY"
     misc_feature    1218..1364
                     /label=last 49 aa from E of Yellow fever virus 17D
                     /note="last 49 aa from E of Yellow fever virus 17D"
     misc_feature    1365..2591
                     /label=NS1 of Yellow fever virus 17D
                     /note="NS1 of Yellow fever virus 17D"
     misc_feature    2592..3482
                     /label=NS2 of Yellow fever virus 17D
                     /note="NS2 of Yellow fever virus 17D"
     misc_feature    3483..5351
                     /label=NS3 of Yellow fever virus 17D
                     /note="NS3 of Yellow fever virus 17D"
     misc_feature    5352..6548
                     /label=NS4 of Yellow fever virus 17D
                     /note="NS4 of Yellow fever virus 17D"
     misc_feature    6549..9266
                     /label=NS5 of Yellow fever virus 17D
                     /note="NS5 of Yellow fever virus 17D"
     misc_feature    9267..9774
                     /label=3UTR of Yellow fever virus 17D
                     /note="3UTR of Yellow fever virus 17D"
     misc_feature    9775..10099
                     /label=antigenomic ribozyme of HDV
                     /note="antigenomic ribozyme of HDV"
     polyA_signal    9984..10065
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(10729..11273)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A 
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(11438..12298)
                     /codon_start=1
                     /product="Bla"
                     /function="ampicillin resistance"
                     /label=Bla
                     /protein_id="ABC61529.1"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(12299..12403)
                     /gene="bla"
                     /label=AmpR promoter
     promoter        12671..2
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"