LOCUS       Exported                4325 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Gateway recycling vector pRED419 DNA, complete sequence.
ACCESSION   AB752379
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4325)
  AUTHORS   Kimura T, Nakao A, Murata S, Kobayashi Y, Tanaka Y, Shibahara K, 
            Kawazu T, Nakagawa T.
  TITLE     Development of the gateway recycling cloning system for multiple 
            linking of expression cassettes in a defined order, and direction on
            gateway compatible binary vectors
  JOURNAL   Biosci. Biotechnol. Biochem. 77 (2), 430-434 (2013)
  PUBMED    23391940
REFERENCE   2  (bases 1 to 4325)
  AUTHORS   Kimura T, Shibahara K, Tanaka Y, Nakao A, Kawazu T, Nakagawa T.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-OCT-2012) Contact:Tsuyoshi Nakagawa Shimane 
            University, Center for Integrated Research in Science; 1060 
            Nishikawatsu, Matsue, Shimane 690-8504, Japan
REFERENCE   3  (bases 1 to 4325)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     constructed using pDONR201.
FEATURES             Location/Qualifiers
     source          1..4325
                     /organism="Gateway recycling vector pRED419"
                     /mol_type="other DNA"
                     /db_xref="taxon:1237880"
     misc_feature    complement(28..127)
                     /label=attL1
                     /note="attL1"
     protein_bind    28..127
                     /gene="mutant version of attL"
                     /label=attL1
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     primer_bind     159..175
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    188..244
                     /label=multi cloning sites
                     /note="multi cloning sites"
     primer_bind     complement(245..261)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    complement(803..927)
                     /label=attR4
                     /note="attR4"
     protein_bind    803..927
                     /gene="mutant version of attR"
                     /label=attR4
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        952..982
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an ""up"" mutation"
     misc_feature    1254..1302
                     /label=rare cutter sites
                     /note="rare cutter sites"
     misc_feature    1569..1693
                     /label=attR3
                     /note="attR3"
     protein_bind    complement(1569..1692)
                     /gene="mutant version of attR"
                     /label=attR3
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     misc_feature    2198..2297
                     /label=attL2
                     /note="attL2"
     protein_bind    complement(2198..2297)
                     /gene="mutant version of attL"
                     /label=attL2
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             2420..3229
                     /codon_start=1
                     /gene="kan"
                     /product="kanamycin resistance protein"
                     /label=kan
                     /protein_id="BAM62102.1"
                     /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP
                     DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA
                     FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD
                     FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD
                     RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     gene            2420..3229
                     /gene="kan"
                     /label=kan
     rep_origin      3350..3989
                     /label=pUC origin
                     /note="pUC origin"
     rep_origin      3372..3960
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     terminator      4095..4122
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB 
                     gene"
     terminator      4214..4300
                     /gene="Escherichia coli rrnB"
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB 
                     gene"