LOCUS       Exported                3575 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pQE-30NAST-attB, complete sequence.
ACCESSION   AY386205
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3575)
  AUTHORS   Kersten B, Feilner T, Kramer A, Wehrmeyer S, Possling A, Witt I, 
            Zanor MI, Stracke R, Lueking A, Kreutzberger J, Lehrach H, Cahilll 
            DJ.
  TITLE     Generation of Arabidopsis protein chips for antibody and serum 
            screening
  JOURNAL   Plant Mol. Biol. 52 (5), 999-1010 (2003)
  PUBMED    14558660
REFERENCE   2  (bases 1 to 3575)
  AUTHORS   Kersten B, Feilner T, Kramer A, Wehrmeyer S, Possling A, Witt I, 
            Zanor MI, Stracke R, Lueking A, Kreutzberger J, Lehrach H, Cahill 
            DJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-SEP-2003) Max-Planck Institute for Molecular Genetics,
            Ihnestrasse 73, Berlin 14195, Germany
REFERENCE   3  (bases 1 to 3575)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..3575
                     /organism="Cloning vector pQE-30NAST-attB"
                     /lab_host="Escherichia coli"
                     /mol_type="other DNA"
                     /db_xref="taxon:247469"
     regulatory      7..87
                     /regulatory_class="promoter"
                     /note="T5 promoter/lac operator element"
     promoter        10..54
                     /label=T5 promoter
                     /note="bacteriophage T5 promoter for E. coli RNA 
                     polymerase, with embedded lac operator"
     protein_bind    30..46
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     regulatory      30..35
                     /regulatory_class="minus_35_signal"
     regulatory      48..53
                     /regulatory_class="minus_10_signal"
     protein_bind    62..78
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     RBS             97..108
                     /note="strong bacterial ribosome binding site (Elowitz and 
                     Leibler, 2000)"
     regulatory      101..107
                     /regulatory_class="ribosome_binding_site"
     misc_feature    115
                     /label=translation start site for inserts
                     /note="translation start site for inserts"
     misc_feature    118..144
                     /label=coding sequence for Arg-Gly-Ser-6xHis-tag
                     /note="coding sequence for Arg-Gly-Ser-6xHis-tag"
     CDS             127..144
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /label=6xHis
                     /translation="HHHHHH"
     regulatory      151..173
                     /regulatory_class="promoter"
                     /note="SP6 RNA polymerase promoter"
     promoter        152..170
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"
     misc_feature    181..205
                     /label=attB1-site
                     /note="attB1-site"
     protein_bind    181..205
                     /gene="mutant version of attB"
                     /label=attB1
                     /bound_moiety="BP Clonase(TM)"
                     /note="recombination site for the Gateway(R) BP reaction"
     misc_feature    207..240
                     /note="multiple cloning site for SalI, HincII, BssHII, 
                     AscI, and NotI"
     misc_feature    242..266
                     /label=attB2-site
                     /note="attB2-site"
     protein_bind    complement(242..266)
                     /gene="mutant version of attB"
                     /label=attB2
                     /bound_moiety="BP Clonase(TM)"
                     /note="recombination site for the Gateway(R) BP reaction"
     regulatory      complement(281..299)
                     /regulatory_class="promoter"
                     /note="T7 RNA polymerase promoter"
     promoter        complement(282..300)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     terminator      321..415
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"
     CDS             459..1118
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /label=CmR
                     /note="confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     terminator      1183..1269
                     /gene="Escherichia coli rrnB"
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB 
                     gene"
     misc_feature    1425..1565
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(1751..2339)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(2510..3370)
                     /codon_start=1
                     /gene="bla"
                     /product="beta lactamase precursor"
                     /label=bla
                     /note="penicillinase"
                     /protein_id="AAQ90186.1"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQAAMDERNRQIAEIGAS
                     LIKHW"
     gene            complement(2510..3370)
                     /gene="bla"
                     /label=bla
     promoter        complement(3371..3475)
                     /gene="bla"
                     /label=AmpR promoter