LOCUS       Exported                4520 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Plastid transformation vector pPRV111Aatt, complete sequence.
ACCESSION   EF416277
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4520)
  AUTHORS   Kittiwongwattana C, Lutz K, Clark M, Maliga P.
  TITLE     Plastid marker gene excision by the phiC31 phage site-specific 
            recombinase
  JOURNAL   Plant Mol. Biol. 64 (1-2), 137-143 (2007)
  PUBMED    17294253
REFERENCE   2  (bases 1 to 4520)
  AUTHORS   Kittiwongwattana C, Lutz KA, Clark M, Maliga P.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JAN-2007) Waksman Institute, Rutgers University, 190 
            Frelinghuysen Road, Piscataway, NJ 08854, USA
REFERENCE   3  (bases 1 to 4520)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..4520
                     /organism="Plastid transformation vector pPRV111Aatt"
                     /mol_type="other DNA"
                     /db_xref="taxon:426714"
     misc_feature    1..1167
                     /note="derived from Nicotiana tabacum plastid sequence in 
                     GenBank Accession Number Z00044; plastid sequence targeting
                     insertions into the trnV-rps12 intergenic region in pPRV 
                     vectors; described in Nucleic Acids Research (1994) 
                     22:3819-3824"
     misc_feature    1188..1244
                     /note="multiple cloning site; includes HindIII, SphI, PstI,
                     SalI, XbaI, BamHI, SmaI, KpnI, SacI, EcoRI"
     misc_feature    1263..1477
                     /label=Streptomyces phage phiC31 attP attachment sequence
                     /note="Streptomyces phage phiC31 attP attachment sequence"
     CDS             complement(1287..1298)
                     /codon_start=1
                     /product="Factor Xa recognition and cleavage site"
                     /label=Factor Xa site
                     /translation="IEGR"
     protein_bind    1369..1468
                     /label=phage phi-C31 attP
                     /bound_moiety="phage phi-C31 integrase"
                     /note="attachment site of phage phi-C31"
     regulatory      1485..1631
                     /regulatory_class="promoter"
                     /note="derived from tobacco plastid psbA promoter in 
                     GenBank Accession Number Z00044"
     CDS             1632..2423
                     /codon_start=1
                     /gene="aadA"
                     /product="aminoglycoside 3 adenyltransferase"
                     /label=aadA
                     /note="confers streptomycin and spectinomycin resistance to
                     bacteria, plant cells and plastids; derived from Shigella 
                     flexneri AAD in GenBank Accession number X03886"
                     /protein_id="ABN72555.1"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"
     gene            1632..2423
                     /gene="aadA"
                     /label=aadA
     3UTR           2438..2626
                     /note="derived from Nicotiana tabacum psbA in GenBank 
                     Accession Number Z00044"
     misc_feature    2645..2698
                     /label=Streptomyces phage phiC31 attB attachment sequence
                     /note="Streptomyces phage phiC31 attB attachment sequence"
     protein_bind    2657..2690
                     /label=attB
                     /bound_moiety="phage phi-C31 integrase"
                     /note="minimal attB site for the phi-C31 integrase (Groth 
                     et al., 2000)"
     misc_feature    2731..4520
                     /note="derived from Nicotiana tabacum plastid sequence in 
                     GenBank Accession Number Z00044; plastid sequence targeting
                     insertions into the trnV-rps12 intergenic region in pPRV 
                     vectors; described in Nucleic Acids Research (1994) 
                     22:3819-3824"