LOCUS       Exported                3964 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  E.coli-K.pastoris shuttle vector pPpB1_Alpha_S, complete sequence.
ACCESSION   JQ519688
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3964)
  AUTHORS   Naatsaari L, Mistlberger B, Ruth C, Hajek T, Hartner FS, Glieder A.
  TITLE     Deletion of the Pichia pastoris KU70 Homologue Facilitates Platform 
            Strain Generation for Gene Expression and Synthetic Biology
  JOURNAL   PLoS ONE 7 (6), E39720 (2012)
  PUBMED    22768112
REFERENCE   2  (bases 1 to 3964)
  AUTHORS   Naeaetsaari L, Mistlberger B, Ruth C, Hajek T, Hartner F, Glieder A.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JAN-2012) Institute of Molecular Biotechnology, Graz 
            University of Technology, Petersgasse 14/2, Graz, Styria 8010, 
            Austria
REFERENCE   3  (bases 1 to 3964)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: SeqMan v. 7.0.0
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3964
                     /organism="Escherichia coli-Pichia pastoris shuttle vector 
                     pPpB1_Alpha_S"
                     /mol_type="other DNA"
                     /db_xref="taxon:1182035"
     regulatory      141..1071
                     /regulatory_class="promoter"
                     /note="AOX1 promoter"
     misc_feature    1085..1351
                     /note="N-terminal prepro signal; derived from Saccharomyces
                     cerevisiae alpha factor"
     regulatory      1374..1633
                     /regulatory_class="terminator"
                     /note="AOX1 terminator"
     terminator      1374..1620
                     /gene="Pichia pastoris AOX1"
                     /label=AOX1 terminator
                     /note="transcription terminator for AOX1"
     regulatory      1640..2499
                     /regulatory_class="promoter"
                     /note="ADH1 promoter"
     promoter        1783..2487
                     /gene="S. cerevisiae ADH1"
                     /label=ADH1 promoter
                     /note="promoter for alcohol dehydrogenase 1"
     regulatory      2506..2563
                     /regulatory_class="promoter"
                     /note="EM72 synthetic promoter"
     CDS             2566..2940
                     /codon_start=1
                     /product="zeocin resistance protein"
                     /label=zeocin resistance protein
                     /protein_id="AFJ20652.1"
                     /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD
                     VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR
                     EFALRDPAGNCVHFVAEEQD"
     regulatory      2947..3246
                     /regulatory_class="terminator"
                     /note="ADH1 terminator"
     terminator      2947..3134
                     /gene="S. cerevisiae ADH1"
                     /label=ADH1 terminator
                     /note="transcription terminator for the S. cerevisiae 
                     alcohol dehydrogenase 1 (ADH1) gene"
     rep_origin      3272..3944
                     /label=pUC origin of replication
                     /note="pUC origin of replication"
     rep_origin      3298..3886
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"