LOCUS       Exported                4284 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pPigBase1.4 DNA, complete sequence.
ACCESSION   AB254131
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4284)
  AUTHORS   Kojin Y, Mon H, Sakashita K, Tatsuke T, Miyagawa Y, Takahashi M, Lee
            J, Kawaguchi Y, Koga K, Kusakabe T.
  TITLE     Efficient RNA interference induction by long hairpin dsRNAs 
            expressed from chromosomes of the silkworm, Bombyx mori
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4284)
  AUTHORS   Kojin Y, Kusakabe T, Lee J.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-MAR-2006) Contact:Takahiro Kusakabe Kyushu University 
            Graduate School, Bioresource and Bioenviroonmental Sciences; 
            Laboratory of Silkworm Sicences, Hakozaki 6-10-1, Higashi-ku, 
            Fukuoka, Fukuoka 812-8581, Japan
REFERENCE   3  (bases 1 to 4284)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..4284
                     /organism="Cloning vector pPigBase1.4"
                     /mol_type="other DNA"
                     /label=constructed from Escherichia coli sequence
                     /note="constructed from Escherichia coli sequence"
                     /db_xref="taxon:378040"
     rep_origin      2..430
                     /direction=RIGHT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     rep_origin      525..1198
                     /label=pUC origin
                     /note="pUC origin"
     rep_origin      551..1139
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     mobile_element  1442..4102
                     /mobile_element_type="transposon:Tn7"
     mobile_element  1442..1666
                     /mobile_element_type="transposon:Tn7"
                     /note="mini-Tn7 element (right end of the Tn7 transposon)"
     repeat_region   1442..1656
                     /note="Tn7R; terminal repeat of Tn7"
     CDS             complement(1733..2266)
                     /codon_start=1
                     /product="gentamicin-3-acetyltransferase"
                     /function="resistance to gentamicin"
                     /label=gentamicin-3-acetyltransferase
                     /protein_id="BAE92209.1"
                     /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD
                     LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS
                     EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR
                     EEVMHFDIDPSTAT"
     promoter        complement(2455..2483)
                     /gene="intI1 (promoter lies within the coding sequence)"
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     mobile_element  2868..3691
                     /mobile_element_type="transposon:piggyBac"
     repeat_region   2868..2880
                     /note="piggyBac transposable element, TR R; terminal repeat
                     of piggyBac"
     repeat_region   2884..2902
                     /label=piggyBac transposable element, IR R
                     /note="piggyBac transposable element, IR R"
     misc_feature    3195..3228
                     /label=loxP site
                     /note="loxP site"
     protein_bind    3195..3228
                     /label=loxP
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GCATACAT)."
     regulatory      3239..3248
                     /regulatory_class="other"
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     misc_feature    3305..3414
                     /label=5X UAS, upstream activating sequence
                     /note="5X UAS, upstream activating sequence"
     protein_bind    3307..3401
                     /label=5X UAS
                     /bound_moiety="GAL4"
                     /note="five tandem copies of the ""ScaI site"" 17-mer 
                     CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS) 
                     that efficiently binds yeast Gal4 (Webster et al., 1988; 
                     Pfeiffer et al., 2010)"
     repeat_region   3629..3648
                     /label=piggyBac transposable element, IR L
                     /note="piggyBac transposable element, IR L"
     repeat_region   3679..3691
                     /note="piggyBac transposable element, TR L; terminal repeat
                     of piggyBac"
     repeat_region   3937..4102
                     /note="Tn7 L; terminal repeat of Tn7"
     mobile_element  3937..4102
                     /mobile_element_type="transposon:Tn7"
                     /note="mini-Tn7 element (left end of the Tn7 transposon)"