LOCUS       Exported                5750 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Bacterial expression vector pOmIL2, complete sequence.
ACCESSION   LT727435
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5750)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman 
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5750)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, 
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 5750)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..5750
                     /organism="Bacterial expression vector pOmIL2"
                     /mol_type="other DNA"
                     /note="BCCM/LMBP Plasmid collection (Ghent 
                     University,Belgium) accession number LMBP 3074."
                     /db_xref="taxon:1944686"
     regulatory      24..105
                     /regulatory_class="terminator"
                     /note="fd terminator"
     terminator      27..75
                     /label=fd terminator
                     /note="central terminator from bacteriophage fd (Otsuka and
                     Kunisawa, 1982)"
     regulatory      134..215
                     /regulatory_class="terminator"
                     /note="fd terminator"
     terminator      137..185
                     /label=fd terminator
                     /note="central terminator from bacteriophage fd (Otsuka and
                     Kunisawa, 1982)"
     rep_origin      313..768
                     /label=f1 ori
                     /note="f1 ori"
     rep_origin      complement(772..1145)
                     /direction=LEFT
                     /label=pMB1 ori
                     /note="pMB1 ori"
     rep_origin      complement(927..1515)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(1686..2546)
                     /label=ampicillin sensitive
                     /note="ampicillin sensitive"
     CDS             complement(1686..2546)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=AmpR
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVE*S
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     CDS             complement(2861..3520)
                     /codon_start=1
                     /note="unnamed protein product; chloramphenicol resistance"
                     /protein_id="SJL88443.1"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     promoter        complement(3521..3623)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding 
                     chloramphenicol acetyltransferase"
     regulatory      3785..3821
                     /regulatory_class="promoter"
                     /note="tac promoter"
     promoter        3788..3816
                     /label=tac promoter
                     /note="strong E. coli promoter; hybrid between the trp and 
                     lac UV5 promoters"
     misc_feature    3822..3857
                     /label=5 UTR of lacZ, incl. RBS
                     /note="5 UTR of lacZ, incl. RBS"
     protein_bind    3824..3840
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     misc_feature    3872..3884
                     /label=5 UTR of phoA, incl. RBS
                     /note="5 UTR of phoA, incl. RBS"
     CDS             3885..3947
                     /codon_start=1
                     /note="unnamed protein product; phoA signal sequence"
                     /protein_id="SJL88444.1"
                     /translation="MKQSTIALALLPLLFTPVTKA"
     rep_origin      3953..4326
                     /label=pMB1 ori
                     /note="pMB1 ori"
     rep_origin      complement(4330..4785)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 ori"
     regulatory      complement(4883..4964)
                     /regulatory_class="terminator"
                     /note="fd terminator"
     terminator      4913..4961
                     /label=fd terminator
                     /note="central terminator from bacteriophage fd (Otsuka and
                     Kunisawa, 1982)"
     regulatory      complement(4993..5074)
                     /regulatory_class="terminator"
                     /note="fd terminator"
     terminator      5023..5071
                     /label=fd terminator
                     /note="central terminator from bacteriophage fd (Otsuka and
                     Kunisawa, 1982)"
     misc_feature    5108..5124
                     /label=5 UTR of ompA, incl. RBS
                     /note="5 UTR of ompA, incl. RBS"
     CDS             5125..5187
                     /codon_start=1
                     /note="unnamed protein product; ompA signal sequence"
                     /protein_id="SJL88445.1"
                     /translation="MKKTAIAIAVALAGFATVAQA"
     CDS             5191..5640
                     /codon_start=1
                     /note="unnamed protein product; mIL2 mature sequence"
                     /protein_id="SJL88446.1"
                     /translation="APTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENY
                     RNLKLPRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNI
                     RVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIISTSPQ"
     misc_feature    5641..5743
                     /label=3 UTR of mIL2
                     /note="3 UTR of mIL2"