LOCUS       Exported                5655 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pMRI-36, complete sequence.
ACCESSION   KJ502285
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5655)
  AUTHORS   Xie W, Yu H.
  TITLE     Developing a sequential repressing-inducing control strategy for 
            improving carotenoids production in Saccharomyces cerevisiae
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5655)
  AUTHORS   Xie W, Yu H.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-FEB-2014) Department of Chemical and Biological 
            Engineering, Zhejiang University, Institute of Bioengineering, 34 
            TianMuShan Road, Hangzhou, Zhejiang 310028, China
REFERENCE   3  (bases 1 to 5655)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..5655
                     /organism="Cloning vector pMRI-36"
                     /mol_type="other DNA"
                     /db_xref="taxon:1495079"
     misc_feature    22..55
                     /label=Loxp site
                     /note="Loxp site"
     protein_bind    complement(22..55)
                     /label=loxP
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GCATACAT)."
     misc_feature    118..795
                     /label=ERG9 upstream region
                     /note="ERG9 upstream region"
     misc_feature    complement(796..1499)
                     /label=ERG9 partial CDS region
                     /note="ERG9 partial CDS region"
     regulatory      complement(1497..2613)
                     /regulatory_class="promoter"
                     /note="HXT1 promoter derived from S. cerevisiae"
     regulatory      2636..3101
                     /regulatory_class="promoter"
                     /note="TEF1 promoter derived from S. cerevisiae"
     promoter        2681..3088
                     /gene="S. cerevisiae TEF1"
                     /label=TEF1 promoter
                     /note="promoter for EF-1-alpha"
     promoter        3109..3127
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     regulatory      3168..3357
                     /regulatory_class="terminator"
                     /note="CYC1 terminator derived from S. cerevisiae"
     terminator      3168..3357
                     /gene="S. cerevisiae CYC1"
                     /label=CYC1 terminator
                     /note="transcription terminator for CYC1"
     promoter        complement(3370..3388)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_feature    3411..3444
                     /label=Loxp site
                     /note="Loxp site"
     protein_bind    complement(3411..3444)
                     /label=loxP
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GCATACAT)."
     gene            3490..4846
                     /label=kanMX
                     /note="yeast selectable marker conferring kanamycin 
                     resistance (Wach et al., 1994)"
     promoter        3490..3833
                     /label=TEF promoter
                     /note="Ashbya gossypii TEF promoter"
     CDS             3834..4643
                     /codon_start=1
                     /product="aminoglycoside phosphotransferase"
                     /label=aminoglycoside phosphotransferase
                     /note="confers resistance to kanamycin and geneticin"
                     /protein_id="AHY82611.1"
                     /translation="MGKEKTHVSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP
                     DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA
                     FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD
                     FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD
                     RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     terminator      4649..4846
                     /label=TEF terminator
                     /note="Ashbya gossypii TEF terminator"
     rep_origin      complement(4979..5567)
                     /direction=LEFT
                     /label=ColE1 pBR322
                     /note="ColE1 pBR322"