LOCUS       Exported                4105 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Shuttle/suicide vector pMQ89, complete sequence.
ACCESSION   DQ230321
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4105)
  AUTHORS   Shanks RM, Caiazza NC, Hinsa SM, Toutain CM, Otoole GA.
  TITLE     Saccharomyces cerevisiae-Based Molecular Tool Kit for Manipulation 
            of Genes from Gram-Negative Bacteria
  JOURNAL   Appl. Environ. Microbiol. 72 (7), 5027-5036 (2006)
  PUBMED    16820502
REFERENCE   2  (bases 1 to 4105)
  AUTHORS   Shanks RMQ., Caiazza NC, Hinsa SM, Toutain CM, OToole GA.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-SEP-2005) Microbiology and Immunology, Dartmouth 
            Medical School, Vail Building Room 505, Hanover, NH 03755, USA
REFERENCE   3  (bases 1 to 4105)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..4105
                     /organism="Shuttle/suicide vector pMQ89"
                     /mol_type="other DNA"
                     /db_xref="taxon:349294"
     oriT            6..830
                     /label=derived from pEX18-Gm
                     /note="derived from pEX18-Gm"
     oriT            352..461
                     /note="incP origin of transfer"
     regulatory      882..1084
                     /regulatory_class="terminator"
                     /note="T1T2 transcriptional terminator from pEX18-Gm"
     terminator      882..909
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB 
                     gene"
     terminator      1001..1087
                     /gene="Escherichia coli rrnB"
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB 
                     gene"
     CDS             complement(1243..1527)
                     /codon_start=1
                     /gene="lacZ alpha"
                     /product="B-gal alpha peptide"
                     /label=lacZ alpha
                     /note="contains multicloning site"
                     /protein_id="ABB04070.1"
                     /translation="MTMITNSSSVPGDPLESTCRHASLALAVVLQRRDWENPGVTQLNR
                     LAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRAWLFWRMREDFQPDTD"
     gene            complement(1243..1527)
                     /gene="lacZ alpha"
                     /label=lacZ alpha
     primer_bind     1437..1453
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    1457..1513
                     /label=MCS
                     /note="pUC18/19 multiple cloning site"
     primer_bind     complement(1523..1539)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    1547..1563
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(1571..1601)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    1616..1637
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     rep_origin      1902..2502
                     /note="ColE1; pUC derived; derived from pEX18-Gm"
     rep_origin      complement(1925..2513)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(2766..3299)
                     /codon_start=1
                     /gene="aacC1"
                     /product="AacC1"
                     /label=aacC1
                     /note="gentamicin resistance determinant"
                     /protein_id="ABB04071.1"
                     /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD
                     LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS
                     EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR
                     EEVMHFDIDPSTAT"
     gene            complement(2766..3299)
                     /gene="aacC1"
                     /label=aacC1
     promoter        complement(3488..3516)
                     /gene="intI1 (promoter lies within the coding sequence)"
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     promoter        complement(3534..3638)
                     /gene="bla"
                     /label=AmpR promoter