LOCUS       Exported                9808 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector pMON99036, complete sequence.
ACCESSION   JN400388
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9808)
  AUTHORS   Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil 
            VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R, 
            Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME.
  TITLE     Expression of the Arabidopsis thaliana BBX32 Gene in Soybean 
            Increases Grain Yield
  JOURNAL   PLoS ONE 7 (2), E30717 (2012)
  PUBMED    22363475
REFERENCE   2  (bases 1 to 9808)
  AUTHORS   Preuss SB.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-JUL-2011) Yield & Stress Traits, Monsanto Company, 700
            Chesterfield Parkway West, Chesterfield, MO 63017, USA
REFERENCE   3  (bases 1 to 9808)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..9808
                     /organism="Expression vector pMON99036"
                     /mol_type="other DNA"
                     /db_xref="taxon:1089338"
     misc_feature    complement(98..539)
                     /label=derived from A. tumifaciens T-DNA left border
                     /note="derived from A. tumifaciens T-DNA left border"
     misc_feature    360..384
                     /label=LB T-DNA repeat
                     /note="left border repeat from octopine Ach5 T-DNA"
     CDS             1760..1951
                     /codon_start=1
                     /gene="rop"
                     /product="Rop protein, which maintains plasmids at low copy
                     number"
                     /label=rop
                     /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
                     DELYRSCLARFGDDGENL"
     misc_feature    2053..2193
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(2379..2967)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    3498..4386
                     /label=derived from E. coli aadA
                     /note="derived from E. coli aadA"
     CDS             3540..4328
                     /codon_start=1
                     /gene="aadA"
                     /product="aminoglycoside adenylyltransferase (Murphy, 
                     1985)"
                     /label=SmR
                     /note="confers resistance to spectinomycin and 
                     streptomycin"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
     misc_feature    complement(4482..4892)
                     /label=derived from A. tumifaciens T-DNA left border
                     /note="derived from A. tumifaciens T-DNA left border"
     misc_feature    4637..4661
                     /label=LB T-DNA repeat
                     /note="left border repeat from octopine Ach5 T-DNA"
     3UTR           complement(4907..5549)
                     /label=derived from P. sativum RbcS2
                     /note="derived from P. sativum RbcS2"
     terminator      4908..5549
                     /label=E9 terminator
                     /note="terminator and polyadenylation signal from the pea 
                     rbcS-E9 gene"
     misc_feature    complement(5556..6923)
                     /label=derived from A. tumifaciens aroA-CP4
                     /note="derived from A. tumifaciens aroA-CP4"
     misc_feature    complement(6924..7151)
                     /label=derived from A. thaliana ShkG
                     /note="derived from A. thaliana ShkG"
     5UTR           complement(7161..7828)
                     /label=derived from A. thaliana Tsf1
                     /note="derived from A. thaliana Tsf1"
     regulatory      complement(7829..8308)
                     /regulatory_class="promoter"
                     /note="derived from A. thaliana Tsf1"
     regulatory      complement(8332..8868)
                     /regulatory_class="enhancer"
                     /note="FMV 35S"
     misc_feature    complement(8891..9247)
                     /label=derived from A. tumifaciens T-DNA right border
                     /note="derived from A. tumifaciens T-DNA right border"
     misc_feature    8931..8955
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     misc_feature    9419..9775
                     /label=derived from A. tumifaciens T-DNA right border
                     /note="derived from A. tumifaciens T-DNA right border"
     misc_feature    9711..9735
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"