LOCUS       Exported                6014 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Broad host range expression vector pMHE7Tc, complete sequence.
ACCESSION   AY303671
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6014)
  AUTHORS   Fodor BD.
  TITLE     Modular broad-host-range expression vectors for the purification of 
            proteins and protein complexes and their application
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6014)
  AUTHORS   Fodor BD.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAY-2003) Biophysics, BRC Hungarian Academy of 
            Sciences, Temesvari, Szeged, Csongrad 6701, Hungary
REFERENCE   3  (bases 1 to 6014)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..6014
                     /organism="Broad host range expression vector pMHE7Tc"
                     /mol_type="other DNA"
                     /db_xref="taxon:244946"
     primer_bind     189..207
                     /label=T7 promoter primer
                     /note="T7 promoter primer"
     promoter        189..207
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     regulatory      189..205
                     /regulatory_class="promoter"
                     /note="T7 promoter"
     misc_feature    206..231
                     /label=lac operator
                     /note="lac operator"
     protein_bind    208..232
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     RBS             247..269
                     /note="efficient ribosome binding site from bacteriophage 
                     T7 gene 10 (Olins and Rangwala, 1989)"
     regulatory      262..268
                     /regulatory_class="ribosome_binding_site"
     misc_feature    276..278
                     /label=start codon of fusion protein
                     /note="start codon of fusion protein"
     misc_feature    282..305
                     /label=FLAG-tag
                     /note="FLAG-tag"
     CDS             282..305
                     /codon_start=1
                     /product="FLAG(R) epitope tag, followed by an enterokinase 
                     cleavage site"
                     /label=FLAG
                     /translation="DYKDDDDK"
     misc_feature    291..305
                     /label=enterokinase cleaveage site
                     /note="enterokinase cleaveage site"
     misc_feature    318..341
                     /label=Strep-tag II
                     /note="Strep-tag II"
     CDS             318..341
                     /codon_start=1
                     /product="peptide that binds Strep-Tactin(R), an engineered
                     form of streptavidin"
                     /label=Strep-Tag II
                     /translation="WSHPQFEK"
     misc_feature    342..353
                     /label=factor-Xa cleaveage site
                     /note="factor-Xa cleaveage site"
     CDS             342..353
                     /codon_start=1
                     /product="Factor Xa recognition and cleavage site"
                     /label=Factor Xa site
                     /translation="IEGR"
     primer_bind     complement(452..469)
                     /label=T7 terminator primer
                     /note="T7 terminator primer"
     regulatory      465..512
                     /regulatory_class="terminator"
                     /note="T7 terminator"
     terminator      466..513
                     /label=T7 terminator
                     /note="transcription terminator for bacteriophage T7 RNA 
                     polymerase"
     rep_origin      1144..1806
                     /label=pBBR1 oriV
                     /note="pBBR1 oriV"
     CDS             complement(1144..1806)
                     /codon_start=1
                     /product="replication protein for the broad-host-range 
                     plasmid pBBR1 from Bordetella bronchiseptica"
                     /label=pBBR1 Rep
                     /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH
                     HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV
                     NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE
                     PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR"
     rep_origin      1807..2576
                     /label=pBBR1 oriV
                     /note="replication origin of the broad-host-range plasmid 
                     pBBR1 from Bordetella bronchiseptica; requires the pBBR1 
                     Rep protein for replication"
     misc_feature    2800..3793
                     /label=RP4 mob, oriT
                     /note="RP4 mob, oriT"
     regulatory      complement(3883..3998)
                     /regulatory_class="terminator"
                     /note="T4 terminator"
     CDS             complement(4304..5494)
                     /codon_start=1
                     /gene="tet"
                     /product="tetracyclin resistance"
                     /label=tet
                     /protein_id="AAQ82544.1"
                     /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY
                     GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI
                     VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF
                     LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM
                     QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII
                     AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL
                     AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST"
     gene            complement(4304..5494)
                     /gene="tet"
                     /label=tet
     regulatory      5879..5994
                     /regulatory_class="terminator"
                     /note="T4 terminator"