LOCUS       Exported                7632 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pMAM, complete sequence.
ACCESSION   U02443
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7632)
  AUTHORS   Kitts PA.
  TITLE     CLONTECH Vectors On Disc version 1.3
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7632)
  AUTHORS   Kitts PA.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-OCT-1993) Paul A. Kitts, CLONTECH Laboratories, Inc., 
            1020 East Meadow Circle, Palo Alto, CA 94303, USA
REFERENCE   3  (bases 1 to 7632)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     This vector can be obtained from CLONTECH Laboratories, Inc., 1020 
            East Meadow Circle, Palo Alto, CA 94303, USA. To place an order call
            (415) 424-8222 or (800) 662-2566, extension 1. International 
            customers, please contact your local distributor.  For technical 
            information, call (415) 424- 8222 or (800) 662-2566, extension 3. 
            This sequence has been compiled from information in the sequence 
            databases, published literature and other sources, together with 
            partial sequences obtained by CLONTECH; this vector has not been 
            completely sequenced. If you suspect there is an error in this 
            sequence, please contact CLONTECHs Technical Service Department at 
            (415) 424-8222 or (800) 662-2566, extension 3 or E-mail 
            TECH@CLONTECH.COM.
FEATURES             Location/Qualifiers
     source          1..7632
                     /organism="Cloning vector pMAM"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:31817"
     intron          1562..1627
                     /label=small t intron
                     /note="SV40 (simian virus 40) small t antigen intron"
     CDS             1757..1777
                     /codon_start=1
                     /product="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
                     /label=SV40 NLS
                     /translation="PKKKRKV"
     polyA_signal    2202..2336
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     promoter        2349..2678
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     rep_origin      2529..2664
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     intron          3813..3878
                     /label=small t intron
                     /note="SV40 (simian virus 40) small t antigen intron"
     CDS             4008..4028
                     /codon_start=1
                     /product="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
                     /label=SV40 NLS
                     /translation="PKKKRKV"
     polyA_signal    4453..4587
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     promoter        5440..5544
                     /gene="bla"
                     /label=AmpR promoter
     CDS             5545..6405
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=AmpR
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     rep_origin      6576..7164
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    7350..7490
                     /label=bom
                     /note="basis of mobility region from pBR322"