LOCUS       Exported                9698 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Lentivirus shuttle vector pLV.pA+.GS.Luc, complete sequence.
ACCESSION   GU253313
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9698)
  AUTHORS   Goncalves MA, Janssen JM, Holkers M, de Vries AA.
  TITLE     Rapid and sensitive lentivirus vector-based conditional gene 
            expression assay to monitor and quantify cell fusion activity
  JOURNAL   PLoS ONE 5 (6), E10954 (2010)
  PUBMED    20532169
REFERENCE   2  (bases 1 to 9698)
  AUTHORS   Goncalves MAF.V., Janssen JM, Holkers M, de Vries AAF.V.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-DEC-2009) Molecular Cell Biology, Leiden University 
            Medical Center, Einthovenweg 20, Leiden, Zuid Holland 2333 ZC, The 
            Netherlands
REFERENCE   3  (bases 1 to 9698)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..9698
                     /organism="Lentivirus shuttle vector pLV.pA+.GS.Luc"
                     /mol_type="other DNA"
                     /label=derived from HIV-1 and Photinus pyralis (firefly)
                     /note="derived from HIV-1 and Photinus pyralis (firefly)"
                     /db_xref="taxon:715477"
     repeat_region   1..410
                     /note="hybrid 5 LTR derived from Rous sarcoma virus and 
                     HIV-1 LTR sequences"
     promoter        3..229
                     /label=RSV promoter
                     /note="Rous sarcoma virus enhancer/promoter"
     LTR             230..410
                     /label=5 LTR (truncated)
                     /note="truncated 5 long terminal repeat (LTR) from HIV-1"
     misc_feature    457..582
                     /label=HIV-1 Psi
                     /note="packaging signal of human immunodeficiency virus 
                     type 1"
     regulatory      473..588
                     /regulatory_class="other"
                     /note="HIV-1 packaging signal"
     misc_feature    1075..1308
                     /label=RRE
                     /note="The Rev response element (RRE) of HIV-1 allows for 
                     Rev-dependent mRNA export from the nucleus to the 
                     cytoplasm."
     misc_feature    1799..1916
                     /label=cPPT/CTS
                     /note="central polypurine tract and central termination 
                     sequence of HIV-1"
     protein_bind    complement(1943..1990)
                     /label=FRT
                     /bound_moiety="FLP recombinase from the Saccharomyces 
                     cerevisiae 2u plasmid"
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     misc_feature    complement(1943..1976)
                     /note="FRT site; Saccharomyces cerevisiae site-specific 
                     recombinase FLP recognition target site"
     regulatory      complement(2003..2506)
                     /regulatory_class="promoter"
                     /note="Homo sapiens GAPDH promoter"
     regulatory      complement(2583..3109)
                     /regulatory_class="polyA_signal_sequence"
                     /note="rabbit beta-globin poly-A signal"
     polyA_site      2907..2962
                     /label=-beta-globin poly(A) signal
                     /note="rabbit beta-globin polyadenylation signal"
     CDS             complement(3126..4778)
                     /codon_start=1
                     /product="luciferase"
                     /label=luciferase
                     /note="derived from Photinus pyralis; reporter"
                     /protein_id="ADC44103.1"
                     /translation="MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDA
                     HIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAP
                     ANDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQS
                     MYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHA
                     RDPIFGNQIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYK
                     IQSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGY
                     GLTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMS
                     GYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESIL
                     LQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVV
                     FVDEVPKGLTGKLDARKIREILIKAKKGGKIAV"
     regulatory      4775..4784
                     /regulatory_class="other"
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     protein_bind    complement(4837..4884)
                     /label=FRT
                     /bound_moiety="FLP recombinase from the Saccharomyces 
                     cerevisiae 2u plasmid"
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     misc_feature    complement(4837..4870)
                     /note="FRT site; Saccharomyces cerevisiae site-specific 
                     recombinase FLP recognition target site"
     regulatory      complement(4936..5321)
                     /regulatory_class="polyA_signal_sequence"
                     /note="murine metallothionein polyadenylation signal"
     misc_feature    5372..6124
                     /note="Homo sapiens hepatitis B virus posttranscriptional 
                     regulatory element"
     repeat_region   6214..6447
                     /label=self-inactivating 3 LTR
                     /note="self-inactivating 3 LTR"
     LTR             6214..6447
                     /label=3 LTR (Delta-U3)
                     /note="self-inactivating 3 long terminal repeat (LTR) from
                     HIV-1"
     polyA_signal    6519..6640
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      6680..6815
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     promoter        complement(6836..6854)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(6864..6880)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     rep_origin      7025..7480
                     /direction=RIGHT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     promoter        7509..7613
                     /gene="bla"
                     /label=AmpR promoter
     CDS             7798..8175
                     /label=ISS
                     /note="immunostimulatory sequence from the AmpR gene; 
                     contains unmethylated CpG dinucleotides in the context of 
                     5-AACGTT-3 (Sato et al., 1996)"
     rep_origin      8644..9232
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    9520..9541
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     promoter        9556..9586
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    9594..9610
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     9618..9634
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        9655..9673
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"