LOCUS       Exported                9186 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Shuttle vector pLV.DsRed, complete sequence.
ACCESSION   EU048695
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9186)
  AUTHORS   Goncalves MA, de Vries AA, Holkers M, van de Watering MJ, van der 
            Velde I, van Nierop GP, Valerio D, Knaan-Shanzer S.
  TITLE     Human mesenchymal stem cells ectopically expressing full-length 
            dystrophin can complement Duchenne muscular dystrophy myotubes by 
            cell fusion
  JOURNAL   Hum. Mol. Genet. 15 (2), 213-221 (2006)
  PUBMED    16321987
REFERENCE   2  (bases 1 to 9186)
  AUTHORS   Goncalves MA, Swildens J, Holkers M, Narain A, van Nierop GP, van de
            Watering MJ, Knaan-Shanzer S, de Vries AA.
  TITLE     Genetic complementation of human muscle cells via directed stem cell
            fusion
  JOURNAL   Mol. Ther. 16 (4), 741-748 (2008)
  PUBMED    18334989
REFERENCE   3  (bases 1 to 9186)
  AUTHORS   Goncalves MA, de Vries AA.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JUL-2007) Molecular Cell Biology, Leiden University 
            Medical Center, Einthovenweg 20, Leiden 2333 ZC, The Netherlands
REFERENCE   4  (bases 1 to 9186)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..9186
                     /organism="Shuttle vector pLV.DsRed"
                     /mol_type="other DNA"
                     /note="derived from Discosoma sp."
                     /db_xref="taxon:476183"
     repeat_region   1..635
                     /label=HIV-1 5 LTR
                     /note="HIV-1 5 LTR"
     LTR             454..634
                     /label=5 LTR (truncated)
                     /note="truncated 5 long terminal repeat (LTR) from HIV-1"
     misc_feature    681..808
                     /label=HIV-1 Psi
                     /note="packaging signal of human immunodeficiency virus 
                     type 1"
     misc_feature    1459..1692
                     /label=RRE
                     /note="The Rev response element (RRE) of HIV-1 allows for 
                     Rev-dependent mRNA export from the nucleus to the 
                     cytoplasm."
     misc_feature    1789..1906
                     /label=cPPT/CTS
                     /note="central polypurine tract and central termination 
                     sequence of HIV-1"
     regulatory      1981..4377
                     /regulatory_class="promoter"
                     /note="Homo sapiens elongation factor 1 alpha promoter"
     promoter        3196..4377
                     /label=EF-1-alpha promoter
                     /note="strong constitutive promoter for human elongation 
                     factor EF-1-alpha"
     intron          3426..4368
                     /label=EF-1-alpha intron A
                     /note="intron upstream of the start codon of human 
                     EF-1-alpha"
     misc_feature    4407..5753
                     /note="SV40 early genes leader coupled to HTLV1 R sequence 
                     plus the first 39 nucleotides of U5 (SUR)"
     LTR             4485..4753
                     /label=5 LTR (truncated)
                     /note="truncated 5 long terminal repeat (LTR) from human 
                     T-cell leukemia virus (HTLV) type 1"
     promoter        complement(4790..4808)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     regulatory      4894..4903
                     /regulatory_class="other"
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     CDS             4900..5577
                     /codon_start=1
                     /product="red fluorescence protein RedT4-N1"
                     /label=red fluorescence protein RedT4-N1
                     /note="DsRedT4-N1"
                     /protein_id="ABW34374.1"
                     /translation="MASSEDVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAK
                     LKVTKGGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGV
                     VTVTQDSSLQDGCFIYKVKFIGVNFPSDGPVMQKKTMGWEPSTERLYPRDGVLKGEIHK
                     ALKLKDGGHYLVEFKSIYMAKKPVQLPGYYYVDSKLDITSHNEDYTIVEQYERAEGRHH
                     LFL"
     repeat_region   5625..5859
                     /label=HIV-1 3 SIN LTR
                     /note="HIV-1 3 SIN LTR"
     LTR             5626..5858
                     /label=3 LTR (Delta-U3)
                     /note="self-inactivating 3 long terminal repeat (LTR) from
                     HIV-1"
     promoter        complement(5883..5901)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(5922..5938)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    5946..5962
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(5970..6000)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    6015..6036
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     rep_origin      complement(6324..6912)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(7301..7960)
                     /codon_start=1
                     /product="chloramphenicol resistance protein"
                     /label=chloramphenicol resistance protein
                     /protein_id="ABW34375.1"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     promoter        complement(7961..8063)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding 
                     chloramphenicol acetyltransferase"
     promoter        complement(8383..8487)
                     /gene="bla"
                     /label=AmpR promoter
     rep_origin      complement(8513..8968)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     primer_bind     9110..9126
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        9136..9154
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"