LOCUS       Exported                4235 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Shuttle vector pLPV111, complete sequence.
ACCESSION   AY557622
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4235)
  AUTHORS   Axelsson L, Holck A.
  TITLE     The genes involved in production of and immunity to sakacin A, a 
            bacteriocin from Lactobacillus sake Lb706
  JOURNAL   J. Bacteriol. 177 (8), 2125-2137 (1995)
  PUBMED    7721704
REFERENCE   2  (bases 1 to 4235)
  AUTHORS   Sorvig E, Skaugen M, Naterstad K, Eijsink VG, Axelsson L.
  TITLE     Plasmid p256 from Lactobacillus plantarum represents a new type of 
            replicon in lactic acid bacteria, and contains a 
            toxin-antitoxin-like plasmid maintenance system
  JOURNAL   Microbiology (Reading, Engl.) 151 (PT 2), 421-431 (2005)
  PUBMED    15699191
REFERENCE   3  (bases 1 to 4235)
  AUTHORS   Axelsson L.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-FEB-2004) Dept. of Microbiology, MATFORSK, Osloveien 
            1, Aas N-1430, Norway
REFERENCE   4  (bases 1 to 4235)
  AUTHORS   Skaugen M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-FEB-2004) Dept. of Chemistry, Biotechnology, and Food 
            Science, Agricultural University of Norway, Chr. Magnus Falsens vei 
            1, Aas N-1432, Norway
REFERENCE   5  (bases 1 to 4235)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..4235
                     /organism="Shuttle vector pLPV111"
                     /mol_type="other DNA"
                     /note="derived from E. coli cloning vector pGEM7-Zf(+) and 
                     Lactobacillus plasmids p256 and pLUL631; 
                     E.coli/Lactobacillus shuttle vector"
                     /db_xref="taxon:268236"
     misc_feature    10..110
                     /label=multicloning site
                     /note="multicloning site"
     promoter        complement(122..140)
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"
     primer_bind     complement(158..174)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    182..198
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(206..236)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    251..272
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     rep_origin      complement(560..1148)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(1679..2416)
                     /codon_start=1
                     /gene="ermB"
                     /product="ErmB"
                     /label=ermB
                     /note="23S rRNA methylase"
                     /protein_id="AAS77689.1"
                     /translation="MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTT
                     KLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFPNKQRYKIVGNIPYN
                     LSTQIIKKVVFESRASDIYLTVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFH
                     PKPKVNSVLIKLTRHTTDVPDKYWKLYKYFVSKWVNREYRQLFTKNQFRQAMKHAKVNN
                     LSTITYEQVLSIFNSYLLFNGRK"
     gene            complement(1679..2416)
                     /gene="ermB"
                     /label=ermB
     CDS             complement(2513..2596)
                     /codon_start=1
                     /gene="ermBL"
                     /product="ErmBL"
                     /label=ermBL
                     /note="regulatory protein"
                     /protein_id="AAS77688.1"
                     /translation="MLVFQMRNVDKTSTVLKQTKNSDYADK"
     gene            complement(2513..2596)
                     /gene="ermBL"
                     /label=ermBL
     misc_feature    2755..3635
                     /note="p256 replication region; allows replication in 
                     Lactobacillus species"
     rep_origin      complement(3675..4055)
                     /direction=LEFT
                     /label=M13 ori
                     /note="M13 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     CDS             complement(4032..162)
                     /codon_start=1
                     /gene="lacZ-alpha"
                     /product="LacZ-alpha"
                     /label=lacZ-alpha
                     /note="LacZ alpha peptide; allows blue/white screening"
                     /protein_id="AAS77687.2"
                     /translation="MTMITPSYLGDTIEYSSYASNALGALRIQAYRFRTRGTEFLESRG
                     ACDVGPNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS
                     QQLRSLNGEWTRPVAAH"
     gene            complement(4032..162)
                     /gene="lacZ-alpha"
                     /label=lacZ-alpha
     primer_bind     4196..4212
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        4219..2
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"