LOCUS       Exported                4057 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector pIGDMCT7RS, complete sequence.
ACCESSION   DQ485721
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4057)
  AUTHORS   Mikiewicz-Sygula D, Plucienniczak A.
  TITLE     pIGDMCT7RS, the expression vector containing the tRNA ArgU gene and 
            the T7 RNA polymerase terminator sequences
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4057)
  AUTHORS   Mikiewicz-Sygula D, Plucienniczak A.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-APR-2006) Bioengineering, Institut of Biotechnology 
            and Antibiotics, Staroscinska 5, Warsaw 02-516, Poland
REFERENCE   3  (bases 1 to 4057)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..4057
                     /organism="Expression vector pIGDMCT7RS"
                     /mol_type="other DNA"
                     /db_xref="taxon:382399"
     misc_feature    137..964
                     /label=similar to regulatory parts of ColE1-like plasmids
                     /note="similar to regulatory parts of ColE1-like plasmids"
     regulatory      147..152
                     /regulatory_class="minus_35_signal"
                     /note="RNA II; by analogy to ColE1-like replicons"
     regulatory      170..175
                     /regulatory_class="minus_10_signal"
                     /note="RNA II; by analogy to ColE1-like replicons"
     misc_feature    184
                     /note="RNA II trancription start; by analogy to ColE1-like 
                     replicons"
     misc_feature    complement(289)
                     /note="RNA I trancription start; by analogy to ColE1-like 
                     replicons"
     regulatory      complement(297..302)
                     /regulatory_class="minus_10_signal"
                     /note="RNA I; by analogy to ColE1-like replicons"
     regulatory      complement(321..326)
                     /regulatory_class="minus_35_signal"
                     /note="RNA I; by analogy to ColE1-like replicons"
     rep_origin      701
                     /note="OriV; by analogy to ColE1-like replicons"
     promoter        1203..1305
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding 
                     chloramphenicol acetyltransferase"
     CDS             1306..1965
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyl transferase"
                     /label=cat
                     /protein_id="ABF29702.1"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     gene            1306..1965
                     /gene="cat"
                     /label=cat
     CDS             complement(2577..2762)
                     /codon_start=1
                     /gene="rom"
                     /product="RNA one modulator"
                     /label=rom
                     /protein_id="ABF29703.1"
                     /translation="MTRQESAALNMAKFIRAQTLLLLERLEQMDLDEAAGCCEHLHDQA
                     EALYAMLNAQIGEENA"
     gene            complement(2577..2762)
                     /gene="rom"
                     /label=rom
     regulatory      complement(3040..3189)
                     /regulatory_class="terminator"
                     /note="T7 transcription terminator"
     terminator      3078..3125
                     /label=T7 terminator
                     /note="transcription terminator for bacteriophage T7 RNA 
                     polymerase"
     misc_feature    3190..3300
                     /label=multicloning site
                     /note="multicloning site"
     RBS             3251..3273
                     /note="efficient ribosome binding site from bacteriophage 
                     T7 gene 10 (Olins and Rangwala, 1989)"
     regulatory      complement(3301..3323)
                     /regulatory_class="promoter"
                     /note="T7 promoter"
     promoter        complement(3305..3323)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     tRNA            3562..3793
                     /product="tRNA-Arg"
                     /label=codons recognized: AGR
                     /note="codons recognized: AGR"
     tRNA            3636..3712
                     /gene="argU"
                     /product="E. coli tRNA-Arg recognizing AGA and AGG"
                     /label=argU