LOCUS       Exported               11283 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pGZ-DSB-SDSA, complete sequence.
ACCESSION   KY447299
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 11283)
  AUTHORS   Zapotoczny G, Sekelsky J.
  TITLE     Human Cell Assays for Synthesis-Dependent Strand Annealing and 
            Crossing Over During Double-Strand Break Repair
  JOURNAL   G3 (Bethesda) (2017) In press
  PUBMED    28179392
REFERENCE   2  (bases 1 to 11283)
  AUTHORS   Zapotoczny G, Sekelsky J.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JAN-2017) Department of Biology, University of North 
            Carolina, 133 N Medical Dr, Chapel Hill, NC 27599, USA
REFERENCE   3  (bases 1 to 11283)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..11283
                     /organism="Cloning vector pGZ-DSB-SDSA"
                     /mol_type="other DNA"
                     /db_xref="taxon:1958937"
     regulatory      12..1346
                     /regulatory_class="promoter"
                     /note="human elongation factor 1 alpha"
     promoter        165..1346
                     /label=EF-1-alpha promoter
                     /note="strong constitutive promoter for human elongation 
                     factor EF-1-alpha"
     intron          395..1337
                     /label=EF-1-alpha intron A
                     /note="intron upstream of the start codon of human 
                     EF-1-alpha"
     regulatory      1364..1373
                     /regulatory_class="other"
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     misc_feature    1370..1745
                     /label=mCherry delta-I-SceI
                     /note="mCherry delta-I-SceI"
     misc_feature    1556..1573
                     /label=I-SceI site
                     /note="I-SceI site"
     misc_feature    1746..1811
                     /label=MCS
                     /note="multiple cloning site"
     polyA_signal    1935..2056
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(2063..2518)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     promoter        2545..2649
                     /gene="bla"
                     /label=AmpR promoter
     promoter        2651..3008
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     rep_origin      2692..2960
                     /label=SV40 origin
                     /note="SV40 origin"
     rep_origin      2859..2994
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     CDS             3043..3837
                     /codon_start=1
                     /product="kanamycin/neomycin resistance protein"
                     /label=kanamycin/neomycin resistance protein
                     /protein_id="AQR57380.1"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     polyA_signal    4069..4116
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase 
                     polyadenylation signal (Cole and Stacy, 1985)"
     misc_feature    4171..5320
                     /label=5 EF1a-mCherry
                     /note="5 EF1a-mCherry"
     intron          4549..4752
                     /label=EF-1-alpha intron A
                     /note="truncated intron upstream of the start codon of 
                     human EF-1-alpha"
     regulatory      4779..4788
                     /regulatory_class="other"
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     misc_feature    5323..8244
                     /label=copia retrotransposon fragment
                     /note="copia retrotransposon fragment"
     misc_feature    8245..9030
                     /label=3 -mCherry
                     /note="3 -mCherry"
     misc_feature    8773..8838
                     /label=MCS
                     /note="multiple cloning site"
     polyA_signal    8962..9083
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     misc_feature    9418..10291
                     /label=mouse HPRT homology arm
                     /note="mouse HPRT homology arm"
     rep_origin      10581..11169
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"