LOCUS       Exported               10451 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Transformation vector pgR106, complete sequence.
ACCESSION   AY297843
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10451)
  AUTHORS   Lu R, Malcuit I, Moffett P, Ruiz MT, Peart J, Wu AJ, Rathjen JP, 
            Bendahmane A, Day L, Baulcombe DC.
  TITLE     High throughput virus-induced gene silencing implicates heat shock 
            protein 90 in plant disease resistance
  JOURNAL   EMBO J. 22 (21), 5690-5699 (2003)
  PUBMED    14592968
REFERENCE   2  (bases 1 to 10451)
  AUTHORS   Lu R, Malcuit I, Moffett P, Ruiz T, Peart J, Wu A-J., Rathjen J, 
            Bendahmane A, Day L, Baulcombe D.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) Department of Plant Pathology, University of
            California Riverside, 900 University Avenue, Riverside, CA 92521, 
            USA
REFERENCE   3  (bases 1 to 10451)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..10451
                     /organism="Transformation vector pgR106"
                     /mol_type="genomic DNA"
                     /note="PVX-based T-DNA vector for virus induced gene 
                     silencing"
                     /db_xref="taxon:233149"
     misc_feature    join(1..566,8130..10451)
                     /label=binary vector pGreen sequence
                     /note="binary vector pGreen sequence"
     misc_feature    540..562
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA 
                     (truncated)"
     regulatory      567..1002
                     /regulatory_class="promoter"
                     /note="CaMV 35S"
     promoter        659..1004
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     misc_feature    1003..6669
                     /label=Potato virus X strain UK3 5-sequence
                     /note="Potato virus X strain UK3 5-sequence"
     regulatory      1710..1719
                     /regulatory_class="other"
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     misc_feature    6670..6702
                     /label=multiple cloning site
                     /note="multiple cloning site"
     misc_feature    6703..7654
                     /label=Potato virus X strain UK3 3-sequence
                     /note="Potato virus X strain UK3 3-sequence"
     regulatory      7655..7934
                     /regulatory_class="terminator"
                     /note="Nos terminator"
     terminator      7679..7931
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     misc_feature    7935..8102
                     /label=shuttle vector pSK5640 sequence
                     /note="shuttle vector pSK5640 sequence"
     primer_bind     complement(7938..7954)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        complement(8121..8139)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(8160..8176)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    8184..8200
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(8208..8238)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    8253..8274
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     misc_feature    8513..8537
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     rep_origin      complement(8628..9216)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(9317..10132)
                     /codon_start=1
                     /gene="aph(3)-Ia"
                     /product="aminoglycoside phosphotransferase"
                     /label=KanR
                     /note="confers resistance to kanamycin in bacteria or G418 
                     (Geneticin(R)) in eukaryotes"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYGLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     rep_origin      10423..407
                     /label=pSa ori
                     /note="origin of replication from bacterial plasmid pSa"