LOCUS       Exported                6229 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Mini-Tn7 cloning and delivery vector pGP-Tn7-Tp, complete sequence.
ACCESSION   JQ429760
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6229)
  AUTHORS   Crepin S, Harel J, Dozois CM.
  TITLE     Chromosomal complementation using Tn7 transposon vectors in 
            Enterobacteriaceae
  JOURNAL   Appl. Environ. Microbiol. 78 (17), 6001-6008 (2012)
  PUBMED    22706059
REFERENCE   2  (bases 1 to 6229)
  AUTHORS   Crepin S, Harel J, Dozois CM.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-2012) Microbiology and Biothechnology, 
            INRS-Institut Armand-Frappier, 531, boul. des Prairies, Laval, 
            Quebec H7V 1B7, Canada
REFERENCE   3  (bases 1 to 6229)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..6229
                     /organism="Mini-Tn7 cloning and delivery vector
                     pGP-Tn7-Tp"
                     /mol_type="other DNA"
                     /db_xref="taxon:1201162"
     mobile_element  189..2230
                     /mobile_element_type="transposon:mini-Tn7"
     repeat_region   189..387
                     /note="Tn7R; right end of Tn7"
     primer_bind     392..408
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      436..530
                     /regulatory_class="terminator"
                     /note="bacteriophage lambda T0 transcriptional terminator"
     terminator      436..530
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"
     regulatory      627..724
                     /regulatory_class="terminator"
                     /note="Escherichia coli rrnB T1 transcriptional terminator"
     terminator      633..719
                     /gene="Escherichia coli rrnB"
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB 
                     gene"
     protein_bind    765..812
                     /label=FRT
                     /bound_moiety="FLP recombinase from the Saccharomyces 
                     cerevisiae 2u plasmid"
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     misc_recomb     766..812
                     /note="FRT; Flp recombinase target site"
     promoter        897..987
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding 
                     chloramphenicol acetyltransferase"
     protein_bind    1017..1064
                     /label=FRT
                     /bound_moiety="FLP recombinase from the Saccharomyces 
                     cerevisiae 2u plasmid"
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     misc_recomb     1018..1064
                     /note="FRT; Flp recombinase target site"
     CDS             complement(1126..1362)
                     /codon_start=1
                     /gene="dhfrII"
                     /product="dihydrofolate reductase"
                     /label=dhfrII
                     /note="trimethoprim resistant"
                     /protein_id="AFM78089.1"
                     /translation="MGQSSDEANAPVAGQFALPLSATFGLGDRVRKKSGAAWQGQVVGW
                     YCTKLTPEGYAVESESHPGSVQIYPVAALERVA"
     gene            complement(1126..1362)
                     /gene="dhfrII"
                     /label=dhfrII
     promoter        complement(1688..1716)
                     /gene="intI1 (promoter lies within the coding sequence)"
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     protein_bind    1768..1815
                     /label=FRT
                     /bound_moiety="FLP recombinase from the Saccharomyces 
                     cerevisiae 2u plasmid"
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     misc_recomb     1768..1814
                     /note="FRT; Flp recombinase target site"
     protein_bind    1905..1952
                     /label=FRT
                     /bound_moiety="FLP recombinase from the Saccharomyces 
                     cerevisiae 2u plasmid"
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     misc_recomb     1905..1951
                     /note="FRT; Flp recombinase target site"
     misc_feature    1979..2064
                     /note="MCS; multiple cloning site"
     mobile_element  2065..2230
                     /mobile_element_type="transposon:Tn7"
                     /note="mini-Tn7 element (left end of the Tn7 transposon)"
     promoter        2626..2730
                     /gene="bla"
                     /label=AmpR promoter
     CDS             2731..3591
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=bla
                     /protein_id="AFM78090.1"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     gene            2731..3591
                     /gene="bla"
                     /label=bla
     oriT            4065..5792
                     /note="oriT origin of transfer; mob RP4"
     CDS             complement(4657..5028)
                     /codon_start=1
                     /gene="traJ"
                     /product="oriT-recognizing protein"
                     /label=traJ
                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV
                     GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE
                     KQDELGKVMMGVVRPRAEP"
     oriT            5061..5170
                     /note="incP origin of transfer"
     rep_origin      5802..6173
                     /label=R6K origin of replication
                     /note="R6K origin of replication"
     rep_origin      5814..6170
                     /label=R6K gamma ori
                     /note="gamma replication origin from E. coli plasmid R6K; 
                     requires the R6K initiator protein pi for replication"