LOCUS       Exported                7890 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Agrobacterium binary gap repair vector pGAP-Km, complete sequence.
ACCESSION   EU933992
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7890)
  AUTHORS   Bitrian M, Roodbarkelari F, Horvath M, Koncz C.
  TITLE     BAC-recombineering for studying plant gene regulation: developmental
            control and cellular localization of SnRK1 kinase subunits
  JOURNAL   Plant J. 65 (5), 829-842 (2011)
  PUBMED    21235649
REFERENCE   2  (bases 1 to 7890)
  AUTHORS   Bitrian M, Koncz C.
  TITLE     Agrobacterium binary gap repair vectors for recombineering with 
            Arabidopsis BACs
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 7890)
  AUTHORS   Bitrian M, Koncz C.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUL-2008) Plant Developmental Biology, Max-Planck 
            Institute for Plant Breeding Research, Carl-von-Linne-Weg 10, 
            Cologne, NRW 50829, Germany
REFERENCE   4  (bases 1 to 7890)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..7890
                     /organism="Agrobacterium binary gap repair vector pGAP-Km"
                     /mol_type="other DNA"
                     /db_xref="taxon:556551"
     misc_feature    1..57
                     /note="polylinker: EcoRI, HindIII, HindIII, XbaI, BglII, 
                     PstI, SalI, BamHI, BstEII"
     misc_feature    complement(58..617)
                     /note="Agrobacterium str. Ach5 Ti plasmid T-DNA encoded 
                     octopine synthase gene polyadenylation sequences"
     CDS             complement(790..1587)
                     /codon_start=1
                     /gene="aphII"
                     /product="AphII"
                     /label=aphII
                     /note="kanamycin phosphotransferase; transposon Tn5 encoded
                     aminoglycoside (kanamycin) phosphotransferase"
                     /protein_id="ACH73255.1"
                     /translation="MWIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGR
                     PVLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLL
                     SSHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEH
                     QGLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDI
                     ALATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRFLDEFF"
     gene            complement(790..1587)
                     /gene="aphII"
                     /label=aphII
     regulatory      complement(1600..1893)
                     /regulatory_class="promoter"
                     /note="Agrobacterium str. C58 Ti plasmid T-DNA encoded 
                     nopaline synthase (NOS) gene promoter"
     promoter        complement(1629..1808)
                     /label=NOS promoter
                     /note="nopaline synthase promoter"
     misc_feature    1893..2873
                     /note="Agrobacterium str. C58 Ti plasmid (gb|AE007871.2) 
                     T-DNA right border region"
     misc_feature    1932..1956
                     /note="Agrobacterium str. C58 Ti plasmid T-DNA right 
                     border; 25bp repeat"
     misc_feature    2974..3893
                     /note="Birmingham IncP-alpha plasmid RK2 
                     (gb|L27758.1|BIACOMGEN; NC_001621) traJXIH/oriT region"
     oriT            3159..3268
                     /note="incP origin of transfer"
     misc_feature    3265..3266
                     /label=oriT nick site
                     /note="oriT nick site"
     rep_origin      3894..4777
                     /note="Birmingham IncP-alpha plasmid RK2 
                     (gb|L27758.1|BIACOMGEN; NC_001621) oriV replication origin;
                     TrfA binding repeats"
     rep_origin      4062..4773
                     /label=oriV
                     /note="incP origin of replication"
     misc_feature    4778..5073
                     /note="derived from Birmingham IncP-alpha plasmid RK2 
                     (gb|L27758.1|BIACOMGEN; NC_001621)"
     misc_feature    5074..5663
                     /note="Agrobacterium str. Ach5 Ti plasmid T-DNA left border
                     region KpnI-ClaI fragment"
     misc_feature    5360..5385
                     /note="Agrobacterium str. Ach5 Ti plasmid T-DNA left 
                     border; 25bp repeat"
     misc_feature    5360..5384
                     /label=LB T-DNA repeat
                     /note="left border repeat from octopine Ach5 T-DNA"
     misc_feature    5664..7890
                     /label=derived from pBluescript SKII(-)
                     /note="derived from pBluescript SKII(-)"
     rep_origin      complement(5872..6460)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(6631..7491)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=AmpR
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPVAMQTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     promoter        complement(7492..7596)
                     /gene="bla"
                     /label=AmpR promoter