LOCUS       Exported                4202 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector pFUSE-rFc2-adapt-scFv, complete sequence.
ACCESSION   FJ716125
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4202)
  AUTHORS   Moutel S, El Marjou A, Vielemeyer O, Nizak C, Benaroch P, Dubel S, 
            Perez F.
  TITLE     A multi-Fc-species system for recombinant antibody production
  JOURNAL   BMC Biotechnol. 9, 14 (2009)
  PUBMED    19245715
REFERENCE   2  (bases 1 to 4202)
  AUTHORS   Perez F, Moutel S.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-FEB-2009) CNRS UMR144, Institut Curie / CNRS, 26, rue 
            dUlm, Pa, Paris 75005, France
REFERENCE   3  (bases 1 to 4202)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..4202
                     /organism="Expression vector pFUSE-rFc2-adapt-scFv"
                     /mol_type="other DNA"
                     /db_xref="taxon:622699"
     promoter        35..246
                     /label=EF-1-alpha core promoter
                     /note="core promoter for human elongation factor 
                     EF-1-alpha"
     LTR             259..527
                     /label=5 LTR (truncated)
                     /note="truncated 5 long terminal repeat (LTR) from human 
                     T-cell leukemia virus (HTLV) type 1"
     CDS             577..636
                     /codon_start=1
                     /product="human interleukin-2 signal sequence"
                     /label=IL-2 signal sequence
                     /translation="MYRMQLLSCIALSLALVTNS"
     misc_feature    644..649
                     /note="NcoI restriction site: upstream insertion site for 
                     scFv"
     misc_feature    661..668
                     /note="NotI restriction site; downstream insertion site for
                     scFv"
     misc_feature    676..1347
                     /label=Fc domain derived from rabbit immunoglobulin IgG2
                     /note="Fc domain derived from rabbit immunoglobulin IgG2"
     polyA_signal    1367..1488
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     polyA_site      1592..1986
                     /label=-beta-globin poly(A)
                     /note="human beta-globin polyadenylation signal"
     CDS             complement(2000..2374)
                     /codon_start=1
                     /product="Ble"
                     /label=Ble
                     /note="derived from Streptoalloteichus hindustanus; confers
                     resistance to zeocin in both Escherichia coli and mammals"
                     /protein_id="ACN67532.1"
                     /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD
                     VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR
                     EFALRDPAGNCVHFVAEEQD"
     enhancer        2967..3270
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     rep_origin      complement(3350..3938)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     polyA_signal    4050..4098
                     /note="synthetic polyadenylation signal"
     misc_feature    4109..4200
                     /label=pause site
                     /note="RNA polymerase II transcriptional pause signal from 
                     the human alpha-2 globin gene"