LOCUS       Exported                4715 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pEnEOi9mycThsp, complete sequence.
ACCESSION   KF537343
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4715)
  AUTHORS   Koiwa H.
  TITLE     Arabidopsis thaliana CPL4 is an essential CTD-phosphatase
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4715)
  AUTHORS   Koiwa H.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-AUG-2013) Department of Horticultural Science, Texas 
            A&M University, MS2133 TAMU, College Station, TX 77843-2133, USA
REFERENCE   3  (bases 1 to 4715)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4715
                     /organism="Cloning vector pEnEOi9mycThsp"
                     /mol_type="other DNA"
                     /db_xref="taxon:1424656"
     rep_origin      complement(63..651)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(741..1550)
                     /codon_start=1
                     /product="KanR"
                     /label=KanR
                     /protein_id="AHA62528.1"
                     /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP
                     DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA
                     FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD
                     FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD
                     RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     protein_bind    1673..1772
                     /gene="mutant version of attL"
                     /label=attL2
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     misc_recomb     1674..1769
                     /label=AttL2
                     /note="AttL2"
     regulatory      1798..2551
                     /regulatory_class="promoter"
                     /note="enhanced cauliflower mosaic virus 35S promoter EL2"
     promoter        2506..2551
                     /label=minimal CaMV 35S promoter
                     /note="minimal 35S promoter from cauliflower mosaic virus"
     regulatory      2555..2625
                     /regulatory_class="other"
                     /note="derived from Tobacco Mosaic Virus Omega sequence"
     intron          2646..3240
                     /note="derived from EF1a"
     misc_feature    3304..3651
                     /label=9xmyc tag
                     /note="9xmyc tag"
     CDS             3307..3336
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     CDS             3343..3372
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     CDS             3379..3408
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     CDS             3427..3456
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     CDS             3463..3492
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     CDS             3499..3528
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     CDS             3547..3576
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     CDS             3583..3612
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     CDS             3619..3648
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     3UTR           3712..3871
                     /label=HSP18.2
                     /note="HSP18.2"
     regulatory      3872..3961
                     /regulatory_class="terminator"
                     /note="HSP18.2 terminator"
     terminator      3986..4238
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     protein_bind    complement(4259..4358)
                     /gene="mutant version of attL"
                     /label=attL1
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     misc_recomb     4262..4357
                     /label=AttL1
                     /note="AttL1"
     terminator      4408..4435
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB 
                     gene"
     terminator      4527..4613
                     /gene="Escherichia coli rrnB"
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB 
                     gene"