LOCUS       Exported                6458 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pDC-KHT, complete sequence.
ACCESSION   JF430587
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6458)
  AUTHORS   Crivat G, Tokumasu F, Sa JM, Hwang J, Wellems TE.
  TITLE     Tetracysteine-Based Fluorescent Tags to Study Protein Localization 
            and Trafficking in Plasmodium falciparum-Infected Erythrocytes
  JOURNAL   PLoS ONE 6 (8), E22975 (2011)
  PUBMED    21860664
REFERENCE   2  (bases 1 to 6458)
  AUTHORS   Crivat G, Tokumasu F, Sa JM, Hwang J, Wellems TE.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-FEB-2011) LMVR, NIAID, 12735 Twinbrook Pkwy, 3E10C, 
            Rockville, MD 20852, USA
REFERENCE   3  (bases 1 to 6458)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..6458
                     /organism="Cloning vector pDC-KHT"
                     /mol_type="other DNA"
                     /clone="pDC-KHT"
                     /note="derived from Plasmodium falciparum; transfection 
                     plasmid expressing KAHRP followed by TC tag"
                     /db_xref="taxon:1035313"
     CDS             complement(878..895)
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /label=6xHis
                     /translation="HHHHHH"
     CDS             complement(896..925)
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     CDS             complement(941..958)
                     /codon_start=1
                     /product="tetracysteine peptide that binds biarsenical 
                     labeling reagents"
                     /label=tetracysteine tag
                     /translation="CCPGCC"
     CDS             complement(995..1021)
                     /codon_start=1
                     /product="9xHis affinity tag"
                     /label=9xHis
                     /translation="HHHHHHHHH"
     CDS             complement(1082..1099)
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /label=6xHis
                     /translation="HHHHHH"
     CDS             complement(1115..1132)
                     /codon_start=1
                     /product="HQHQHQ metal affinity tag"
                     /label=HQ tag
                     /note="The HQ tag binds to nickel and other metal ions much
                     like the 6xHis tag, but may allow elution at lower 
                     concentrations of imidazole (Godat et al., 2008)."
                     /translation="HQHQHQ"
     CDS             complement(1121..1138)
                     /codon_start=1
                     /product="HQHQHQ metal affinity tag"
                     /label=HQ tag
                     /note="The HQ tag binds to nickel and other metal ions much
                     like the 6xHis tag, but may allow elution at lower 
                     concentrations of imidazole (Godat et al., 2008)."
                     /translation="HQHQHQ"
     CDS             complement(1136..1156)
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /label=7xHis
                     /translation="HHHHHHH"
     promoter        complement(3776..3793)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(3800..3816)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        4290..4394
                     /gene="bla"
                     /label=AmpR promoter
     CDS             4395..5255
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=AmpR
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     rep_origin      5426..6014
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    6302..6323
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     promoter        6338..6368
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    6376..6392
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     6400..6416
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        6434..6452
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"