LOCUS       Exported                3757 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Shuttle vector pCRB15 DNA, complete sequence.
ACCESSION   AB444683
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3757)
  AUTHORS   Tsuchida Y, Kimura S, Suzuki N, Inui M, Yukawa H.
  TITLE     Characterization of a 24-kb plasmid pCGR2 newly isolated from 
            Corynebacterium glutamicum
  JOURNAL   Appl. Microbiol. Biotechnol. 87 (5), 1855-1866 (2010)
  PUBMED    20552356
REFERENCE   2  (bases 1 to 3757)
  AUTHORS   Inui M, Suzuki N, Noburyu R, Yukawa H.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUL-2008) Contact:Masayuki Inui Research Institute of 
            Innovative Technology for the Earth, Molecular Microbiology and 
            Biotechnology Group; 9-2 kizugawadai, Kizugawa, Kyoto 619-0292, 
            Japan URL :http://www.rite.or.jp/
REFERENCE   3  (bases 1 to 3757)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..3757
                     /organism="Shuttle vector pCRB15"
                     /mol_type="other DNA"
                     /note="Corynebacterium glutamicum-Escherichia coli shuttle 
                     vector pCRB15"
                     /db_xref="taxon:545646"
     misc_feature    1..465
                     /note="derived from Escherichia coli cloning vector 
                     pSELECT-zeo-mcs"
     CDS             complement(11..385)
                     /codon_start=1
                     /gene="Shble"
                     /product="zeocin registance"
                     /label=Shble
                     /protein_id="BAG54978.1"
                     /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD
                     VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR
                     EFALRDPAGNCVHFVAEEQD"
     gene            complement(11..385)
                     /gene="Shble"
                     /label=Shble
     promoter        complement(395..413)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     promoter        complement(405..451)
                     /label=EM7 promoter
                     /note="synthetic bacterial promoter "
     misc_feature    472..1833
                     /note="derived from Escherichia coli cloning vector 
                     pHSG398"
     protein_bind    673..694
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     promoter        709..739
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    747..763
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     771..787
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             783..1013
                     /codon_start=1
                     /product="lac alpha"
                     /label=lac alpha
                     /protein_id="BAG54979.1"
                     /translation="MTMITNSSSVPGDPLESTCRHASLALAVVLQRRDWENPGVTQLNR
                     LAAHPPFASWRNSEEARTDRPSQQLRSLNGE"
     misc_feature    797..853
                     /label=MCS, multiple cloning site
                     /note="MCS, multiple cloning site"
     primer_bind     complement(857..873)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     rep_origin      complement(1199..1787)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    1840..3724
                     /note="derived from Corynebacteriumt glutamicum cryptric 
                     plasmid pCG1"