LOCUS       Exported                4194 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Gateway conversion vector pCON DNA, complete sequence.
ACCESSION   AB752380
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4194)
  AUTHORS   Kimura T, Nakao A, Murata S, Kobayashi Y, Tanaka Y, Shibahara K, 
            Kawazu T, Nakagawa T.
  TITLE     Development of the gateway recycling cloning system for multiple 
            linking of expression cassettes in a defined order, and direction on
            gateway compatible binary vectors
  JOURNAL   Biosci. Biotechnol. Biochem. 77 (2), 430-434 (2013)
  PUBMED    23391940
REFERENCE   2  (bases 1 to 4194)
  AUTHORS   Kimura T, Shibahara K, Tanaka Y, Nakao A, Kawazu T, Nakagawa T.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-OCT-2012) Contact:Tsuyoshi Nakagawa Shimane 
            University, Center for Integrated Research in Science; 1060 
            Nishikawatsu, Matsue, Shimane 690-8504, Japan
REFERENCE   3  (bases 1 to 4194)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     constructed using pDONR201.
FEATURES             Location/Qualifiers
     source          1..4194
                     /organism="Gateway conversion vector pCON"
                     /mol_type="other DNA"
                     /db_xref="taxon:1237881"
     misc_feature    complement(28..127)
                     /label=attL4
                     /note="attL4"
     protein_bind    29..124
                     /gene="mutant version of attL"
                     /label=attL4
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     primer_bind     652..668
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    complement(676..800)
                     /label=attR1
                     /note="attR1"
     protein_bind    676..800
                     /gene="mutant version of attR"
                     /label=attR1
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        825..855
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an ""up"" mutation"
     misc_feature    1127..1175
                     /label=rare cutter sites
                     /note="rare cutter sites"
     misc_feature    1442..1566
                     /label=attR2
                     /note="attR2"
     protein_bind    complement(1442..1566)
                     /gene="mutant version of attR"
                     /label=attR2
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     misc_feature    2067..2166
                     /label=attL3
                     /note="attL3"
     protein_bind    complement(2070..2165)
                     /gene="mutant version of attL"
                     /label=attL3
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             2289..3098
                     /codon_start=1
                     /gene="kan"
                     /product="kanamycin resistance protein"
                     /label=kan
                     /protein_id="BAM62103.1"
                     /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP
                     DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA
                     FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD
                     FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD
                     RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     gene            2289..3098
                     /gene="kan"
                     /label=kan
     rep_origin      3219..3858
                     /label=pUC origin
                     /note="pUC origin"
     rep_origin      3241..3829
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     terminator      3964..3991
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB 
                     gene"
     terminator      4083..4169
                     /gene="Escherichia coli rrnB"
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB 
                     gene"