LOCUS       Exported                3793 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Binary vector pCLEAN-G185, complete sequence.
ACCESSION   EU186084
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3793)
  AUTHORS   Thole V, Worland B, Snape JW, Vain P.
  TITLE     The pCLEAN dual binary vector system for Agrobacterium-mediated 
            plant transformation
  JOURNAL   Plant Physiol. 145 (4), 1211-1219 (2007)
  PUBMED    17932303
REFERENCE   2  (bases 1 to 3793)
  AUTHORS   Thole V, Vain P.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2007) Department of Crop Genetics, John Innes 
            Centre, Colney Lane, Norwich NR4 7UH, UK
REFERENCE   3  (bases 1 to 3793)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..3793
                     /organism="Binary vector pCLEAN-G185"
                     /mol_type="other DNA"
                     /db_xref="taxon:478695"
     misc_feature    1..2481
                     /note="Cloning vector pGreenII0000 (Genbank Accession 
                     Number EF590266)-based backbone sequence"
     rep_origin      1..720
                     /label=pUC-ori
                     /note="pUC-ori"
     rep_origin      complement(61..649)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(820..1635)
                     /codon_start=1
                     /gene="nptI"
                     /product="NptI"
                     /label=nptI
                     /note="kanamycin resistance"
                     /protein_id="ABW84164.1"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANVVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     gene            complement(820..1635)
                     /gene="nptI"
                     /label=nptI
     rep_origin      1921..2473
                     /label=pSa-ori
                     /note="pSa-ori"
     rep_origin      1926..2361
                     /label=pSa ori
                     /note="origin of replication from bacterial plasmid pSa"
     misc_feature    2482..3793
                     /note="Basic pCLEAN T-DNA region no. 6 including minimal 
                     T-DNA of 102 nucleotides (Thole et al., 2007; 
                     http://www.jic.ac.uk/staff/philippe-vain/vectors.htm)"
     misc_feature    2508..2532
                     /note="T-DNA left border No. 1 sequence belonging to a 
                     double left border sequence separated by a 26-nt long 
                     spacer sequence from left border No. 2 sequence (Thole et 
                     al., 2007); left border No. 1 is a 25-nt long consensus 
                     sequence of the nopaline vector pTiT37 (Slightom et al., 
                     (1985) EMBO J 4:3069-3077)"
     misc_feature    2533..2558
                     /note="26-nt long spacer sequence separating left border 
                     No. 1 and No. 2 of the double left border sequence (Thole 
                     et al., 2007)"
     misc_feature    2559..2583
                     /note="T-DNA left border No. 2 sequence belonging to a 
                     double left border sequence separated by a 26-nt long 
                     spacer sequence from left border No. 1 sequence (Thole et 
                     al., 2007); left border No. 2 is a 25-nt long consensus 
                     sequence of the nopaline vector pTiT37 (Slightom et al., 
                     (1985) EMBO J 4:3069-3077)"
     misc_feature    2584..2635
                     /note="Inner T-DNA region containing 52 nt-long multiple 
                     cloning site with NotI, PacI, SfiI, BsiWI, ApaI, XhoI and 
                     SalI restriction sites"
     misc_feature    2636..2660
                     /note="25-nt long consensus T-DNA right border sequence of 
                     the nopaline vector pTiT37 (Slightom et al., (1985) EMBO J 
                     4:3069-3077)"
     misc_feature    2661..2684
                     /note="right border overdrive sequence (Peralta et al. 
                     (1986) EMBO J 5: 1137-1142)"
     CDS             2894..3697
                     /codon_start=1
                     /gene="virGwt"
                     /product="VirGwt"
                     /label=virGwt
                     /note="wild-type virG"
                     /protein_id="ABW84165.1"
                     /translation="MIVHPSRENFSSAVNKGSDFRLKGEPLKHVLLVDDDVAMRHLIIE
                     YLTIHAFKVTAVADSTQFTRVLSSATVDVVVVDLNLGREDGLEIVRNLAAKSDIPIIII
                     SGDRLEETDKVVALELGASDFIAKPFSIREFLARIRVALRVRPNVVRSKDRRSFCFTDW
                     TLNLRQRRLMSEAGGEVKLTAGEFNLLLAFLEKPRDVLSREQLLIASRVRDEEVYDRSI
                     DVLILRLRRKLEADPSSPQLIKTARGAGYFFDADVQVSHGGTMAA"
     gene            2894..3697
                     /gene="virGwt"
                     /label=virGwt