LOCUS       Exported               11728 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pC-(lox2-attB2-SA-Hsp70)3, complete sequence.
ACCESSION   KP686439
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 11728)
  AUTHORS   Diao F, Ironfield H, Luan H, Diao F, Shropshire WC, Ewer J, Marr E, 
            Potter CJ, Landgraf M, White BH.
  TITLE     Plug-and-Play Genetic Access to Drosophila Cell Types using 
            Exchangeable Exon Cassettes
  JOURNAL   Cell Rep 10 (8), 1410-1421 (2015)
  PUBMED    25732830
REFERENCE   2  (bases 1 to 11728)
  AUTHORS   Diao F, Luan H, White BH.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JAN-2015) Laboratory of Molecular Biology, NIMH, NIH, 
            35 Convent Dr, Bethesda, MD 20850, USA
REFERENCE   3  (bases 1 to 11728)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Vector NTI v. Version 11
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..11728
                     /organism="Cloning vector pC-(lox2-attB2-SA-Hsp70)3"
                     /mol_type="other DNA"
                     /db_xref="taxon:1620443"
     misc_feature    15..242
                     /label=Carl_P5 P-element
                     /note="Carl_P5 P-element"
     rep_origin      complement(235..823)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(994..1854)
                     /codon_start=1
                     /gene="ampR"
                     /product="Amp resistance protein"
                     /label=ampR
                     /protein_id="AJQ21602.1"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     gene            complement(994..1854)
                     /gene="ampR"
                     /label=ampR
     promoter        complement(1855..1959)
                     /gene="bla"
                     /label=AmpR promoter
     misc_feature    2761..2993
                     /label=P element 3 end
                     /note="P element 3 end"
     promoter        3017..3035
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     misc_feature    3069..4358
                     /label=phase 0
                     /note="phase 0"
     misc_recomb     3069..3102
                     /label=lox2272
                     /note="lox2272"
     protein_bind    complement(3069..3102)
                     /label=lox2272
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GGATACTT). lox2272 sites are compatible with each
                     other, but incompatible with loxP or loxN sites."
     misc_feature    3103..3202
                     /label=spacer sequence between lox2272 and attB
                     /note="spacer sequence between lox2272 and attB"
     misc_recomb     3203..3302
                     /label=attB
                     /note="attB"
     protein_bind    3218..3287
                     /label=attB
                     /bound_moiety="phage phi-C31 integrase"
                     /note="attB site for the phi-C31 integrase (Groth et al., 
                     2000)"
     misc_feature    3315..3414
                     /label=MHC splice acceptor site
                     /note="MHC splice acceptor site"
     misc_feature    3448..3467
                     /label=multiple cloning site
                     /note="multiple cloning site"
     misc_feature    3468..3958
                     /label=Hsp70 ployA
                     /note="Hsp70 ployA"
     misc_recomb     complement(4125..4224)
                     /label=attB
                     /note="attB"
     protein_bind    4140..4209
                     /label=attB
                     /bound_moiety="phage phi-C31 integrase"
                     /note="attB site for the phi-C31 integrase (Groth et al., 
                     2000)"
     misc_feature    4225..4324
                     /label=spacer sequence between lox2272 and attB
                     /note="spacer sequence between lox2272 and attB"
     misc_recomb     4325..4358
                     /label=lox2272
                     /note="lox2272"
     protein_bind    complement(4325..4358)
                     /label=lox2272
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GGATACTT). lox2272 sites are compatible with each
                     other, but incompatible with loxP or loxN sites."
     misc_feature    4359..4378
                     /label=spacer sequence between between lox2272 and loxN
                     /note="spacer sequence between between lox2272 and loxN"
     misc_feature    4379..5668
                     /label=phase 1
                     /note="phase 1"
     misc_recomb     4379..4412
                     /label=loxN
                     /note="loxN"
     protein_bind    complement(4379..4412)
                     /label=loxN
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GTATACCT). loxN sites are compatible with each 
                     other, but incompatible with loxP or lox2272 sites."
     misc_feature    4413..4512
                     /label=spacer sequence between loxN and attB
                     /note="spacer sequence between loxN and attB"
     misc_recomb     4513..4612
                     /label=attB
                     /note="attB"
     protein_bind    4528..4597
                     /label=attB
                     /bound_moiety="phage phi-C31 integrase"
                     /note="attB site for the phi-C31 integrase (Groth et al., 
                     2000)"
     misc_feature    4625..4724
                     /label=MHC splice acceptor site
                     /note="MHC splice acceptor site"
     misc_feature    4760..4779
                     /label=multiple cloning site
                     /note="multiple cloning site"
     misc_feature    4780..5270
                     /label=Hsp70 polyA
                     /note="Hsp70 polyA"
     misc_recomb     complement(5435..5534)
                     /label=attB
                     /note="attB"
     protein_bind    5450..5519
                     /label=attB
                     /bound_moiety="phage phi-C31 integrase"
                     /note="attB site for the phi-C31 integrase (Groth et al., 
                     2000)"
     misc_feature    5535..5634
                     /label=spacer sequence between attB and loxN
                     /note="spacer sequence between attB and loxN"
     misc_recomb     5635..5668
                     /label=loxN
                     /note="loxN"
     protein_bind    complement(5635..5668)
                     /label=loxN
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GTATACCT). loxN sites are compatible with each 
                     other, but incompatible with loxP or lox2272 sites."
     misc_feature    5669..5688
                     /label=spacer sequence between loxN and loxP
                     /note="spacer sequence between loxN and loxP"
     misc_feature    5689..6978
                     /label=phase 2
                     /note="phase 2"
     misc_recomb     5689..5722
                     /label=loxP
                     /note="loxP"
     protein_bind    complement(5689..5722)
                     /label=loxP
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GCATACAT)."
     misc_feature    5723..5822
                     /label=spacer sequence between loxP and attB
                     /note="spacer sequence between loxP and attB"
     misc_recomb     5823..5922
                     /label=attB
                     /note="attB"
     protein_bind    5838..5907
                     /label=attB
                     /bound_moiety="phage phi-C31 integrase"
                     /note="attB site for the phi-C31 integrase (Groth et al., 
                     2000)"
     misc_feature    5935..6034
                     /label=MHC splice acceptor site
                     /note="MHC splice acceptor site"
     misc_feature    6069..6088
                     /label=MCS
                     /note="MCS"
     misc_feature    6089..6579
                     /label=Hsp70 ployA
                     /note="Hsp70 ployA"
     misc_recomb     complement(6745..6844)
                     /label=attB
                     /note="attB"
     protein_bind    6760..6829
                     /label=attB
                     /bound_moiety="phage phi-C31 integrase"
                     /note="attB site for the phi-C31 integrase (Groth et al., 
                     2000)"
     misc_feature    6845..6944
                     /label=spacer sequence between attB and loxP
                     /note="spacer sequence between attB and loxP"
     misc_feature    6945..6978
                     /label=loxP
                     /note="loxP"
     protein_bind    complement(6945..6978)
                     /label=loxP
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GCATACAT)."
     misc_feature    7001..11127
                     /label=white gene marker
                     /note="white gene marker"
     CDS             join(7483..7554,7949..8222,8297..8951,9013..9328,9549..9680,
                     9751..10365)
                     /codon_start=1
                     /gene="white"
                     /product="Drosophila white gene eye color pigment"
                     /label=mini-white
                     /note="This is a modified version of the white gene lacking
                     part of the first intron."
                     /translation="MGQEDQELLIRGGSKHPSAEHLNNGDSGAASQSCINQGFGQAKNY
                     GTLLPPSPPEDSGSGSGQLAENLTYAWHNMDIFGAVNQPGSGWRQLVNRTRGLFCNERH
                     IPAPRKHLLKNVCGVAYPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNG
                     QPVDAKEMQARCAYVQQDDLFIGSLTAREHLIFQAMVRMPRHLTYRQRVARVDQVIQEL
                     SLSKCQHTIIGVPGRVKGLSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQ
                     VLKKLSQKGKTVILTIHQPSSELFELFDKILLMAEGRVAFLGTPSEAVDFFSYVGAQCP
                     TNYNPADFYVQVLAVVPGREIESRDRIAKICDNFAISKVARDMEQLLATKNLEKPLEQP
                     ENGYTYKATWFMQFRAVLWRSWLSVLKEPLLVKVRLIQTTMVAILIGLIFLGQQLTQVG
                     VMNINGAIFLFLTNMTFQNVFATINVFTSELPVFMREARSRLYRCDTYFLGKTIAELPL
                     FLTVPLVFTAIAYPMIGLRAGVLHFFNCLALVTLVANVSTSFGYLISCASSSTSMALSV
                     GPPVIIPFLLFGGFFLNSGSVPVYLKWLSYLSWFRYANEGLLINQWADVEPGEISCTSS
                     NTTCPSSGKVILETLNFSAADLPLDYVGLAILIVSFRVLAYLALRLRARRKE"
     misc_feature    11141..11728
                     /label=Carl_P3 P-element
                     /note="Carl_P3 P-element"
     misc_feature    11143..11728
                     /label=P element 5 end