LOCUS       Exported                3259 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pACpET24, complete sequence.
ACCESSION   U16281
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3259)
  AUTHORS   Elce JS, Hegadorn C, Gauthier S, Vince JW, Davies PL.
  TITLE     Recombinant calpain II: improved expression systems and production 
            of a C105A active-site mutant for crystallography
  JOURNAL   Protein Eng. 8 (8), 843-848 (1995)
  PUBMED    8637855
REFERENCE   2  (bases 1 to 3259)
  AUTHORS   Elce JS.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-OCT-1994) John S. Elce, Biochemistry, Queens 
            University, Kingston, Ontario K7L 3N6, Canada
REFERENCE   3  (bases 1 to 3259)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..3259
                     /organism="Cloning vector pACpET24"
                     /plasmid="pACpET24"
                     /lab_host="Escherichia coli"
                     /mol_type="genomic DNA"
                     /note="based on plasmid pACYC177, Genbank Accession Number 
                     X06402"
                     /db_xref="taxon:39121"
     rep_origin      783..1328
                     /direction=RIGHT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A 
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     rep_origin      complement(1326..1328)
                     /direction=LEFT
                     /label=A15 origin of replication
                     /note="A15 origin of replication"
     misc_feature    2471..2538
                     /label=multiple cloning site
                     /note="multiple cloning site"
     CDS             complement(2504..2536)
                     /codon_start=1
                     /product="leader peptide from bacteriophage T7 gene 10"
                     /label=T7 tag (gene 10 leader)
                     /note="promotes efficient translation in E. coli"
                     /translation="MASMTGGQQMG"
     RBS             2543..2565
                     /note="efficient ribosome binding site from bacteriophage 
                     T7 gene 10 (Olins and Rangwala, 1989)"
     regulatory      complement(2544..2552)
                     /regulatory_class="ribosome_binding_site"
     protein_bind    2580..2604
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     regulatory      complement(2580..2600)
                     /regulatory_class="promoter"
                     /note="from T7 RNA polymerase"
     promoter        complement(2605..2623)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     promoter        2912..3016
                     /gene="bla"
                     /label=AmpR promoter
     CDS             3017..618
                     /codon_start=1
                     /product="beta-lactamase"
                     /function="ampicillin resistance"
                     /EC_number="3.5.2.6"
                     /label=beta-lactamase
                     /note="similar to PIR Accession Number P00810"
                     /protein_id="AAB05650.1"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"