LOCUS       Exported               14325 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  YFV replicon vector FMDV-2A-def, complete sequence.
ACCESSION   DQ322634
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 14325)
  AUTHORS   Shustov AV, Frolov IV.
  TITLE     Trans-packaging of Yellow Fever virus replicons: an approach for 
            flaviviral antigen production
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 14325)
  AUTHORS   Shustov AV, Frolov IV.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-DEC-2005) Department of Microbiology and Immunology, 
            University of Texas Medical Branch, 301 University Boulevard, 
            Galveston, TX 77550-1019, USA
REFERENCE   3  (bases 1 to 14325)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..14325
                     /organism="YFV replicon vector FMDV-2A-def"
                     /focus
                     /lab_host="Escherichia coli"
                     /mol_type="other DNA"
                     /db_xref="taxon:364084"
     source          2..197
                     /organism="Yellow fever virus 17D"
                     /mol_type="other DNA"
                     /db_xref="taxon:11090"
     source          915..11412
                     /organism="Yellow fever virus 17D"
                     /mol_type="other DNA"
                     /db_xref="taxon:11090"
     misc_feature    2..119
                     /label=5UTR of Yellow fever virus 17D
                     /note="5UTR of Yellow fever virus 17D"
     misc_feature    120..194
                     /note="first 25 aa of Yellow fever virus 17D capsid 
                     protein"
     misc_feature    198..914
                     /label=green fluorescent protein (GFP)
                     /note="green fluorescent protein (GFP)"
     CDS             198..914
                     /codon_start=1
                     /product="enhanced GFP"
                     /label=EGFP
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYK"
     misc_feature    918..968
                     /label=2A protease of Foot-and-Mouth Disease Virus
                     /note="2A protease of Foot-and-Mouth Disease Virus"
     misc_feature    969..1031
                     /note="last 21 aa of Yellow fever virus 17D capsid protein"
     misc_feature    1032..1298
                     /label=PR of Yellow fever virus 17D
                     /note="PR of Yellow fever virus 17D"
     misc_feature    1299..1523
                     /label=M of Yellow fever virus 17D
                     /note="M of Yellow fever virus 17D"
     misc_feature    1524..3002
                     /label=E of Yellow fever virus 17D
                     /note="E of Yellow fever virus 17D"
     misc_feature    3003..4229
                     /label=NS1 of Yellow fever virus 17D
                     /note="NS1 of Yellow fever virus 17D"
     misc_feature    4230..5120
                     /label=NS2 of Yellow fever virus 17D
                     /note="NS2 of Yellow fever virus 17D"
     misc_feature    5121..6989
                     /label=NS3 of Yellow fever virus 17D
                     /note="NS3 of Yellow fever virus 17D"
     misc_feature    6990..8186
                     /label=NS4 of Yellow fever virus 17D
                     /note="NS4 of Yellow fever virus 17D"
     misc_feature    8187..10904
                     /label=NS5 of Yellow fever virus 17D
                     /note="NS5 of Yellow fever virus 17D"
     misc_feature    10905..11412
                     /label=3UTR of Yellow fever virus 17D
                     /note="3UTR of Yellow fever virus 17D"
     misc_feature    11413..11737
                     /label=antigenomic ribozyme of HDV
                     /note="antigenomic ribozyme of HDV"
     polyA_signal    11622..11703
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(12367..12911)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A 
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(13076..13936)
                     /codon_start=1
                     /product="Bla"
                     /function="ampicillin resistance"
                     /label=Bla
                     /protein_id="ABC61528.1"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     promoter        complement(13937..14041)
                     /gene="bla"
                     /label=AmpR promoter
     promoter        14309..2
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"