LOCUS       Exported               14295 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  YFV replicon vector capsid-def, complete sequence.
ACCESSION   DQ322633
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 14295)
  AUTHORS   Shustov AV, Frolov IV.
  TITLE     Trans-packaging of Yellow Fever virus replicons: an approach for 
            flaviviral antigen production
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 14295)
  AUTHORS   Shustov AV, Frolov IV.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-DEC-2005) Department of Microbiology and Immunology, 
            University of Texas Medical Branch, 301 University Boulevard, 
            Galveston, TX 77550-1019, USA
REFERENCE   3  (bases 1 to 14295)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..14295
                     /organism="YFV replicon vector capsid-def"
                     /focus
                     /lab_host="Escherichia coli"
                     /mol_type="other DNA"
                     /db_xref="taxon:364083"
     source          2..197
                     /organism="Yellow fever virus 17D"
                     /mol_type="other DNA"
                     /db_xref="taxon:11090"
     source          915..11382
                     /organism="Yellow fever virus 17D"
                     /mol_type="other DNA"
                     /db_xref="taxon:11090"
     misc_feature    2..119
                     /label=5UTR of Yellow fever virus 17D
                     /note="5UTR of Yellow fever virus 17D"
     misc_feature    120..194
                     /note="first 25 aa of Yellow fever virus 17D capsid 
                     protein"
     misc_feature    198..914
                     /label=green fluorescent protein (GFP)
                     /note="green fluorescent protein (GFP)"
     CDS             198..914
                     /codon_start=1
                     /product="enhanced GFP"
                     /label=EGFP
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYK"
     misc_feature    918..1001
                     /note="last 28 aa of Yellow fever virus 17D capsid protein"
     misc_feature    1002..1268
                     /label=PR of Yellow fever virus 17D
                     /note="PR of Yellow fever virus 17D"
     misc_feature    1269..1493
                     /label=M of Yellow fever virus 17D
                     /note="M of Yellow fever virus 17D"
     misc_feature    1494..2972
                     /label=E of Yellow fever virus 17D
                     /note="E of Yellow fever virus 17D"
     misc_feature    2973..4199
                     /label=NS1 of Yellow fever virus 17D
                     /note="NS1 of Yellow fever virus 17D"
     misc_feature    4200..5090
                     /label=NS2 of Yellow fever virus 17D
                     /note="NS2 of Yellow fever virus 17D"
     misc_feature    5091..6959
                     /label=NS3 of Yellow fever virus 17D
                     /note="NS3 of Yellow fever virus 17D"
     misc_feature    6960..8156
                     /label=NS4 of Yellow fever virus 17D
                     /note="NS4 of Yellow fever virus 17D"
     misc_feature    8157..10874
                     /label=NS5 of Yellow fever virus 17D
                     /note="NS5 of Yellow fever virus 17D"
     misc_feature    10875..11382
                     /label=3UTR of Yellow fever virus 17D
                     /note="3UTR of Yellow fever virus 17D"
     misc_feature    11383..11707
                     /label=antigenomic ribozyme of HDV
                     /note="antigenomic ribozyme of HDV"
     polyA_signal    11592..11673
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(12337..12881)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A 
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(13046..13906)
                     /codon_start=1
                     /product="Bla"
                     /function="ampicillin resistance"
                     /label=Bla
                     /protein_id="ABC61527.1"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     promoter        complement(13907..14011)
                     /gene="bla"
                     /label=AmpR promoter
     promoter        14279..2
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"