LOCUS       Exported                3280 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pVP16, complete sequence.
ACCESSION   U89963
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3280)
  AUTHORS   Holtz A, Lou Y.
  TITLE     pVP16 complete sequence
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3280)
  AUTHORS   Holtz A, Lou Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-FEB-1997) CLONTECH Laboratories, Inc., 1020 East 
            Meadow Circle, Palo Alto, CA 94303-4230, USA
REFERENCE   3  (bases 1 to 3280)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     This vector can be obtained from CLONTECH Laboratories, Inc., 1020 
            East Meadow Circle, Palo Alto, CA 94303-4230, USA. To place an order
            call (415) 424-8222 or (800) 662-2566, extension 1. International 
            customers, please contact your local distributor. For technical 
            information, call (415) 424-8222 or (800) 662-2566, extension 3.
            This sequence has been compiled from information in the sequence 
            databases, published literature and other sources, together with 
            partial sequences obtained by CLONTECH. If you suspect there is an 
            error in this sequence, please contact CLONTECHs Technical Support 
            Department at (415) 424-8222 or (800) 662-2566, extension 3 or 
            E-mail TECH@CLONTECH.COM.
FEATURES             Location/Qualifiers
     source          1..3280
                     /organism="unidentified cloning vector"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:45196"
     regulatory      1..368
                     /regulatory_class="promoter"
                     /note="SV40 early promoter"
     promoter        20..38
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"
     promoter        67..364
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     regulatory      385..394
                     /regulatory_class="other"
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     CDS             397..417
                     /codon_start=1
                     /product="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
                     /label=SV40 NLS
                     /translation="PKKKRKV"
     CDS             412..672
                     /codon_start=1
                     /product="VP16"
                     /label=VP16
                     /note="Activation domain of VP16"
                     /protein_id="AAB68656.1"
                     /translation="KVAPPTDVSLGDELHLDGEDVAMAHADALDDFDLDMLGDGDSPGP
                     GFTPHDSAPYGALDMADFEFEQMFTDALGIDEYGGEFPGIRR"
     CDS             418..651
                     /codon_start=1
                     /gene="UL48"
                     /product="transcriptional activation domain of herpes 
                     simplex virus protein VP16 (Triezenberg et al., 1988; 
                     Cousens et al., 1989)"
                     /label=VP16 AD
                     /translation="APPTDVSLGDELHLDGEDVAMAHADALDDFDLDMLGDGDSPGPGF
                     TPHDSAPYGALDMADFEFEQMFTDALGIDEYGG"
     polyA_signal    809..943
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     promoter        complement(954..972)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     rep_origin      complement(1230..1818)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     gene            1989..2852
                     /gene="ampR"
                     /label=ampR
     CDS             complement(1989..2849)
                     /codon_start=1
                     /product="beta-lactamase"
                     /function="ampicillin resistance"
                     /label=beta-lactamase
                     /note="2852"
                     /protein_id="AAB68657.1"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERHTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(2850..2954)
                     /gene="bla"
                     /label=AmpR promoter