LOCUS       Exported                4533 bp ds-DNA    circular SYN 28-11-2013
DEFINITION  Vector for expressing proteins C-terminally tagged with 
            streptavidin- and calmodulin-binding peptides. For other reading 
            frames, use pCTAP-A or pCTAP-C.
ACCESSION   .
VERSION     .
KEYWORDS    pCTAP-B
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4533)
  AUTHORS   Agilent Technologies
  TITLE     Direct Submission
COMMENT     The cloned gene must include a Kozak sequence and start codon.
FEATURES             Location/Qualifiers
     source          1..4533
                     /organism="synthetic DNA construct"
                     /lab_host="Mammalian Cells"
                     /mol_type="other DNA"
     enhancer        66..370
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        371..574
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     promoter        620..638
                     /note="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"
     misc_feature    651..744
                     /note="MCS"
                     /note="multiple cloning site"
     CDS             763..876
                     /codon_start=1
                     /product="streptavidin-binding peptide"
                     /note="SBP"
                     /note="selected from a peptide library; binds streptavidin 
                     with nanomolar affinity"
                     /translation="MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP"
     CDS             904..981
                     /codon_start=1
                     /product="calmodulin-binding peptide"
                     /note="CBP"
                     /note="derived from skeletal muscle myosin light chain 
                     kinase; binds calmodulin with nanomolar affinity in the 
                     presence of calcium"
                     /translation="KRRWKKNFIAVSAANRFKKISSSGAL"
     misc_feature    997..1007
                     /note="stop codons"
                     /note="stop codons in all three reading frames"
     promoter        complement(1035..1053)
                     /note="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     polyA_signal    1327..1448
                     /note="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(1455..1910)
                     /direction=LEFT
                     /note="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     promoter        1937..2039
                     /gene="bla"
                     /note="AmpR promoter"
     promoter        2043..2400
                     /note="SV40 promoter"
                     /note="SV40 enhancer and early promoter"
     CDS             2435..3229
                     /codon_start=1
                     /gene="aph(3)-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /note="NeoR/KanR"
                     /note="confers resistance to neomycin, kanamycin, and G418 
                     (Geneticin)"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     misc_feature    3461..3508
                     /note="HSV TK poly(A) signal"
                     /note="herpesvirus thymidine kinase polyadenylation signal"
     rep_origin      3837..4425
                     /direction=RIGHT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"