LOCUS       Exported                6087 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pXPG, complete sequence.
ACCESSION   AF262031
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6087)
  AUTHORS   Bert AG, Burrows J, Osborne CS, Cockerill PN.
  TITLE     Generation of an improved luciferase reporter gene plasmid that 
            employs a novel mechanism for high-copy replication
  JOURNAL   Plasmid 44 (2), 173-182 (2000)
  PUBMED    10964627
REFERENCE   2  (bases 1 to 6087)
  AUTHORS   Bert AG, Burrows J, Osborne CS, Cockerill PN.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-MAY-2000) Division of Human Immunology, Hanson Centre 
            For Cancer Research, Institute of Medical and Veterinary Science, 
            Frome Road, Adelaide, SA 5000, Australia
REFERENCE   3  (bases 1 to 6087)
  AUTHORS   Bert AG, Burrows J, Osborne CS, Cockerill PN.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-AUG-2000) Division of Human Immunology, Hanson Centre 
            For Cancer Research, Institute of Medical and Veterinary Science, 
            Frome Road, Adelaide, SA 5000, Australia
REFERENCE   4  (bases 1 to 6087)
  AUTHORS   Cockerill PN.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-MAR-2004) Molecular Medicine, University of Leeds, 
            Clinical Sciences Building, St. Jamess University Hospital, Leeds 
            LS9 7TF, UK
REFERENCE   5  (bases 1 to 6087)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     On Mar 25, 2004 this sequence version replaced AF262031.2.
            The reporter gene plasmid pXPG has been engineered by incorporating 
            a novel high copy origin of replication and the modified Luc+ 
            luciferase gene into the pXP1 vector.
FEATURES             Location/Qualifiers
     source          1..6087
                     /organism="Cloning vector pXPG"
                     /mol_type="other DNA"
                     /note="high-copy number vector derived from cloning vectors
                     pXP1 and pGL3"
                     /db_xref="taxon:124098"
     misc_feature    1..46
                     /label=multiple cloning site
                     /note="multiple cloning site"
     misc_feature    47..1729
                     /label=pGL3 vector sequence
                     /note="pGL3 vector sequence"
     regulatory      70..79
                     /regulatory_class="other"
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     gene            76..1734
                     /gene="Luc+"
                     /label=Luc+
                     /note="modified luciferase gene from plasmid pGL3"
     CDS             76..1728
                     /codon_start=1
                     /gene="Luc+"
                     /product="luciferase"
                     /label=Luc+
                     /protein_id="AAF73967.1"
                     /translation="MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDA
                     HIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAP
                     ANDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQS
                     MYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHA
                     RDPIFGNQIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYK
                     IQSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGY
                     GLTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMS
                     GYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESIL
                     LQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVV
                     FVDEVPKGLTGKLDARKIREILIKAKKGGKIAV"
     misc_feature    1730..46
                     /label=pXP1 vector sequence
                     /note="pXP1 vector sequence"
     intron          1739..2348
                     /note="SV40 small T intron"
     intron          1813..1878
                     /label=small t intron
                     /note="SV40 (simian virus 40) small t antigen intron"
     CDS             2008..2028
                     /codon_start=1
                     /product="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
                     /label=SV40 NLS
                     /translation="PKKKRKV"
     regulatory      2349..3338
                     /regulatory_class="polyA_signal_sequence"
                     /note="SV40 early polyA signal; compiled from the pXP1 SV40
                     sequence except for deletion of TTG which is missing in the
                     equivalent SV40 elements upstream of the multiple cloning 
                     site"
     polyA_signal    2450..2584
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     misc_feature    2584
                     /note="BamHI site destroyed and a ClaI site created by 
                     end-filling and religation of the BamHI site"
     promoter        3441..3545
                     /gene="bla"
                     /label=AmpR promoter
     CDS             3546..4406
                     /codon_start=1
                     /gene="b-lactamase"
                     /product="beta-lactamase"
                     /label=b-lactamase
                     /protein_id="AAF73968.1"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     gene            3546..4406
                     /gene="b-lactamase"
                     /label=b-lactamase
                     /note="AMP-R"
     rep_origin      4577..5165
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     variation       4604
                     /replace="a"
                     /label=high-copy number origin of replication mutation
                     /note="high-copy number origin of replication mutation"
     rep_origin      5168
     misc_feature    5351..5491
                     /label=bom
                     /note="basis of mobility region from pBR322"
     regulatory      5633..5862
                     /regulatory_class="polyA_signal_sequence"
                     /note="SV40 early polyA signal"
     polyA_signal    5730..5864
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     regulatory      5863..6087
                     /regulatory_class="polyA_signal_sequence"
                     /note="SV40 early polyA signal"
     polyA_signal    5958..5
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"