LOCUS       Exported                4880 bp ds-DNA     circular SYN 13-MAY-2021
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    CHOP promoter (-649/+136) pmCherry-1
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4880)
  AUTHORS   Oh RS, Pan WC, Yalcin A, Zhang H, Guilarte TR, Hotamisligil GS, 
            Christiani DC, Lu Q
  TITLE     Functional RNA Interference (RNAi) Screen Identifies System A 
            Neutral Amino Acid Transporter 2 (SNAT2) as a Mediator of 
            Arsenic-induced Endoplasmic Reticulum Stress.
  JOURNAL   J Biol Chem. 2012 Feb 17;287(8):6025-34. Epub 2012 Jan 3.
  PUBMED    22215663
REFERENCE   2  (bases 1 to 4880)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J Biol 
            Chem."; date: "2012-02-17"; volume: "287(8)"; pages: "6025-34. Epub 
            2012 Jan 3"
FEATURES             Location/Qualifiers
     source          1..4880
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     regulatory      831..840
                     /regulatory_class="other"
                     /label=Kozak sequence
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     CDS             837..1547
                     /codon_start=1
                     /product="monomeric derivative of DsRed fluorescent protein
                     (Shaner et al., 2004)"
                     /label=mCherry
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEG
                     TQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF
                     EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK
                     GEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERA
                     EGRHSTGGMDELYK"
     primer_bind     complement(982..1000)
                     /label=mCherry-R
                     /note="mCherry, reverse primer"
     primer_bind     1250..1269
                     /label=mCherry-F
                     /note="mCherry, forward primer"
     polyA_signal    1668..1789
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(1705..1724)
                     /label=SV40pA-R
                     /note="SV40 polyA, reverse primer"
     primer_bind     1759..1778
                     /label=EBV-rev
                     /note="SV40 polyA terminator, reverse primer"
     rep_origin      complement(1796..2251)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     primer_bind     complement(1933..1954)
                     /label=F1ori-F
                     /note="F1 origin, forward primer"
     primer_bind     2145..2164
                     /label=F1ori-R
                     /note="F1 origin, reverse primer"
     promoter        2278..2382
                     /gene="bla"
                     /label=AmpR promoter
     promoter        2384..2741
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     primer_bind     complement(2407..2427)
                     /label=pBABE 3
                     /note="SV40 enhancer, reverse primer for pBABE vectors"
     rep_origin      2592..2727
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     primer_bind     2654..2673
                     /label=SV40pro-F
                     /note="SV40 promoter/origin, forward primer"
     CDS             2776..3570
                     /codon_start=1
                     /gene="aph(3)-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /label=NeoR/KanR
                     /note="confers resistance to neomycin, kanamycin, and G418 
                     (Geneticin(R))"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     primer_bind     complement(2830..2849)
                     /label=Neo-R
                     /note="Neomycin resistance gene, reverse primer"
     primer_bind     3440..3459
                     /label=Neo-F
                     /note="Neomycin resistance gene, forward primer"
     primer_bind     complement(3758..3777)
                     /label=TK-pA-R
                     /note="Thymidine kinase polyA, reverse primer"
     polyA_signal    3802..3849
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase 
                     polyadenylation signal (Cole and Stacy, 1985)"
     rep_origin      4178..4766
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     primer_bind     4667..4686
                     /label=pBR322ori-F
                     /note="pBR322 origin, forward primer"